IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Bacterial formate hydrogenlyase complex. Bacterial formate hydrogenlyase complex. Proceedings of the National Academy of Sciences of the United States of America 2014 imex curation McDowall JS., Murphy BJ., Haumann M., Palmer T., Armstrong FA., Sargent F. f.sargent@dundee.ac.uk 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) pull down pull down fingerprinting peptide massfingerprinting fingerprinting McDowall JS., Murphy BJ., Haumann M., Palmer T., Armstrong FA., Sargent F. f.sargent@dundee.ac.uk Accepted 2015-DEC-03 AT 15:21 GMT AT 15:21 GMT by MGT Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation Neutral is correct for gel filtration which is the method described, so I still think correct here. Bacterial formate hydrogenlyase complex. Bacterial formate hydrogenlyase complex. Proceedings of the National Academy of Sciences of the United States of America 2014 imex curation McDowall JS., Murphy BJ., Haumann M., Palmer T., Armstrong FA., Sargent F. f.sargent@dundee.ac.uk 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column fingerprinting peptide massfingerprinting fingerprinting McDowall JS., Murphy BJ., Haumann M., Palmer T., Armstrong FA., Sargent F. Complexes were pre-purified by nickel chromatography then by gel filtration on a Superose 6 column. Fractions were analyzed by SDS-PAGE. Proteins were identified by mass spectrometry and direct sequencing. f.sargent@dundee.ac.uk Accepted 2015-DEC-03 AT 15:21 GMT AT 15:21 GMT by MGT Proceedings of the National Academy of Sciences of the United States of America 2014 Only protein-protein interactions imex curation imex curation Neutral is correct for gel filtration which is the method described, so I still think correct here. hycf_ecoli Formate hydrogenlyase subunit 6 hycF hevF b2720 JW2690 Hydrogenase-3 component F protein protein ecoli Escherichia coli (strain K12) MFTFIKKVIKTGTATSSYPLEPIAVDKNFRGKPEQNPQQCIGCAACVNACPSNALTVETDLATGELAWEFNLGHCIFCGRCEEVCPTAAIKLSQEYELAVWKKEDFLQQSRFALCNCRVCNRPFAVQKEIDYAIALLKHNGDSRAENHRESFETCPECKRQKCLVPSDRIELTRHMKEAI 284B8C507B47DFDC hycg_ecoli Formate hydrogenlyase subunit 7 Hydrogenase-3 component G hycG hevG b2719 JW2689 protein protein ecoli Escherichia coli (strain K12) MSNLLGPRDANGIPVPMTVDESIASMKASLLKKIKRSAYVYRVDCGGCNGCEIEIFATLSPLFDAERFGIKVVPSPRHADILLFTGAVTRAMRSPALRAWQSAPDPKICISYGACGNSGGIFHDLYCVWGGTDKIVPVDVYIPGCPPTPAATLYGFAMALGLLEQKIHARGPGELDEQPAEILHGDMVQPLRVKVDREARRLAGYRYGRQIADDYLTQLGQGEEQVARWLEAENDPRLNEIVSHLNHVVEEARIR DIP protein P16433 original sequence version: null B24FBAE3C44F3A10 hycd_ecoli Formate hydrogenlyase subunit 4 hycD hevD b2722 JW2692 Hydrogenase 3 component D protein protein ecoli Escherichia coli (strain K12) MSVLYPLIQALVLFAVAPLLSGITRVARARLHNRRGPGVLQEYRDIIKLLGRQSVGPDASGWVFRLTPYVMVGVMLTIATALPVVTVGSPLPQLGDLITLLYLFAIARFFFAISGLDTGSPFTAIGASREAMLGVLVEPMLLLGLWVAAQVAGSTNISNITDTVYHWPLSQSIPLVLALCACAFATFIEMGKLPFDLAEAEQELQEGPLSEYSGSGFGVMKWGISLKQLVVLQMFVGVFIPWGQMETFTAGGLLLALVIAIVKLVVGVLVIALFENSMARLRLDITPRITWAGFGFAFLAFVSLLAA 2A3F410620E82AC9 hyce_ecoli Formate hydrogenlyase subunit 5 Hydrogenase-3 component E hycE hevE b2721 JW2691 protein protein ecoli Escherichia coli (strain K12) MSEEKLGQHYLAALNEAFPGVVLDHAWQTKDQLTVTVKVNYLPEVVEFLYYKQGGWLSVLFGNDERKLNGHYAVYYVLSMEKGTKCWITVRVEVDANKPEYPSVTPRVPAAVWGEREVRDMYGLIPVGLPDERRLVLPDDWPDELYPLRKDSMDYRQRPAPTTDAETYEFINELGDKKNNVVPIGPLHVTSDEPGHFRLFVDGENIIDADYRLFYVHRGMEKLAETRMGYNEVTFLSDRVCGICGFAHSTAYTTSVENAMGIQVPERAQMIRAILLEVERLHSHLLNLGLACHFTGFDSGFMQFFRVRETSMKMAEILTGARKTYGLNLIGGIRRDLLKDDMIQTRQLAQQMRREVQELVDVLLSTPNMEQRTVGIGRLDPEIARDFSNVGPMVRASGHARDTRADHPFVGYGLLPMEVHSEQGCDVISRLKVRINEVYTALNMIDYGLDNLPGGPLMVEGFTYIPHRFALGFAEAPRGDDIHWSMTGDNQKLYRWRCRAATYANWPTLRYMLRGNTVSDAPLIIGSLDPCYSCTDRMTVVDVRKKKSKVVPYKELERYSIERKNSPLK DIP protein P16431 original sequence version: null 38A2BCCB01B27463 hycb_ecoli Formate hydrogenlyase subunit 2 hycB hevB b2724 JW2694 Hydrogenase-3 component B protein protein ecoli Escherichia coli (strain K12) MNRFVIADSTLCIGCHTCEAACSETHRQHGLQSMPRLRVMLNEKESAPQLCHHCEDAPCAVVCPVNAITRVDGAVQLNESLCVSCKLCGIACPFGAIEFSGSRPLDIPANANTPKAPPAPPAPARVSTLLDWVPGIRAIAVKCDLCSFDEQGPACVRMCPTKALHLVDNTDIARVSKRKRELTFNTDFGDLTLFQQAQSGEAK 828042E504B00DBD hycc_ecoli Formate hydrogenlyase subunit 3 Hydrogenase-3 component C hycC hevC b2723 JW2693 protein protein ecoli Escherichia coli (strain K12) MSAISLINSGVAWFVAAAVLAFLFSFQKALSGWIAGIGGAVGSLYTAAAGFTVLTGAVGVSGALSLVSYDVQISPLNAIWLITLGLCGLFVSLYNIDWHRHAQVKCNGLQINMLMAAAVCAVIASNLGMFVVMAEIMALCAVFLTSNSKEGKLWFALGRLGTLLLAIACWLLWQRYGTLDLRLLDMRMQQLPLGSDIWLLGVIGFGLLAGIIPLHGWVPQAHANASAPAAALFSTVVMKIGLLGILTLSLLGGNAPLWWGIALLVLGMITAFVGGLYALVEHNIQRLLAYHTLENIGIILLGLGAGVTGIALEQPALIALGLVGGLYHLLNHSLFKSVLFLGAGSVWFRTGHRDIEKLGGIGKKMPVISIAMLVGLMAMAALPPLNGFAGEWVIYQSFFKLSNSGAFVARLLGPLLAVGLAITGALAVMCMAKVYGVTFLGAPRTKEAENATCAPLLMSVSVVALAICCVIGGVAAPWLLPMLSAAVPLPLEPANTTVSQPMITLLLIACPLLPFIIMAICKGDRLPSRSRGAAWVCGYDHEKSMVITAHGFAMPVKQAFAPVLKLRKWLNPVSLVPGWQCEGSALLFRRMALVELAVLVVIIVSRGA DIP protein P16429 original sequence version: null 7E4F4C63626289B8 fdhf_ecoli Formate dehydrogenase H Formate-hydrogen-lyase-linked, selenocysteine-containing polypeptide Formate dehydrogenase-H subunit alpha fdhF b4079 JW4040 protein protein ecoli Escherichia coli (strain K12) MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA C7C86F6F704A142D fdhf-1 1 9 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range association association Fig. 2B hycb-fdhf-1 1 9 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait P16431:p.Gly83_Thr84insGlySer mutation mutation certain certain sequence position certain certain certain sequence position certain GT GGST Wed May 02 17:45:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly83gly_gly_ser' Tue Jun 30 17:38:10 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly83_Thr84insGlySer' gly-83 his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag certain certain sequence position certain certain certain sequence position certain 3 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association Fig. 2B hyce-fdhf-1 1 9 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey association association Fig. 2B hycf-fdhf-1 1 9 unspecified role unspecified role prey prey 4 unspecified role unspecified role bait bait c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig. 2B hycf-fdhf-2 2 9 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component gly-83 his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag certain certain sequence position certain certain certain sequence position certain P16431:p.Gly83_Thr84insGlySer mutation mutation certain certain sequence position certain certain certain sequence position certain GT GGST Wed May 02 16:36:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly83gly_gly_ser' Tue Jun 30 17:36:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly83_Thr84insGlySer' 3 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Fig.4C The strain was lysed in a detergent mixture and subjected to nickel chromatography in the absence of all detergent. fdhf-hycb-1 2 5 edman degradation edman degradation fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role neutral component neutral component 8 edman degradation edman degradation fingerprinting peptide massfingerprinting fingerprinting unspecified role unspecified role neutral component neutral component 9 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component gly-83 his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag certain certain sequence position certain certain certain sequence position certain P16431:p.Gly83_Thr84insGlySer mutation mutation certain certain sequence position certain certain certain sequence position certain GT GGST Wed May 02 19:39:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly83gly_gly_ser' Tue Jun 30 15:57:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly83_Thr84insGlySer' 3 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component physical association physical association Fig.4B The strain was lysed in a detergent mixture and subjected to nickel chromatography in the presence of 0.05% w/v n-dodecyl-beta-D-maltoside.