IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Physical and functional links between anion exchanger-1 and sodium pump. Physical and functional links between anion exchanger-1 and sodium pump. Journal of the American Society of Nephrology : JASN 2015 imex curation Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE., Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE. fek1000@cam.ac.uk 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions human-kidney_cortex human kidney cortex Human kidney-renal_cortex renal cortex confocal microscopy confocal microscopy immunostaining immunostaining Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE., Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE. fek1000@cam.ac.uk Accepted 2015-JUL-02 by ORCHARD Journal of the American Society of Nephrology : JASN 2015 imex curation Physical and functional links between anion exchanger-1 and sodium pump. Physical and functional links between anion exchanger-1 and sodium pump. Journal of the American Society of Nephrology : JASN 2015 imex curation Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE., Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE. fek1000@cam.ac.uk 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE., Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE. fek1000@cam.ac.uk Accepted 2015-JUL-02 by ORCHARD Journal of the American Society of Nephrology : JASN 2015 imex curation Physical and functional links between anion exchanger-1 and sodium pump. Physical and functional links between anion exchanger-1 and sodium pump. Journal of the American Society of Nephrology : JASN 2015 imex curation Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE., Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE. fek1000@cam.ac.uk 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE., Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE. fek1000@cam.ac.uk Accepted 2015-JUL-02 by ORCHARD Journal of the American Society of Nephrology : JASN 2015 imex curation Physical and functional links between anion exchanger-1 and sodium pump. Physical and functional links between anion exchanger-1 and sodium pump. Journal of the American Society of Nephrology : JASN 2015 imex curation Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE., Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE. fek1000@cam.ac.uk 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions human-kidney Human kidney kidney kidney [Renal] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE., Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE. fek1000@cam.ac.uk Accepted 2015-JUL-02 by ORCHARD Journal of the American Society of Nephrology : JASN 2015 imex curation Physical and functional links between anion exchanger-1 and sodium pump. Physical and functional links between anion exchanger-1 and sodium pump. Journal of the American Society of Nephrology : JASN 2015 imex curation Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE., Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE. fek1000@cam.ac.uk 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fluorescence spectr classical fluorescence spectroscopy fluorescence spectr predetermined predetermined participant predetermined Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE., Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE. fek1000@cam.ac.uk Accepted 2015-JUL-02 by ORCHARD Journal of the American Society of Nephrology : JASN 2015 imex curation Physical and functional links between anion exchanger-1 and sodium pump. Physical and functional links between anion exchanger-1 and sodium pump. Journal of the American Society of Nephrology : JASN 2015 imex curation Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE., Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE. fek1000@cam.ac.uk 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE., Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE. fek1000@cam.ac.uk Accepted 2015-JUL-02 by ORCHARD Human kidney cDNA Journal of the American Society of Nephrology : JASN 2015 imex curation Physical and functional links between anion exchanger-1 and sodium pump. Physical and functional links between anion exchanger-1 and sodium pump. Journal of the American Society of Nephrology : JASN 2015 imex curation Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE., Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE. fek1000@cam.ac.uk 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE., Su Y., Al-Lamki RS., Blake-Palmer KG., Best A., Golder ZJ., Zhou A., Karet Frankl FE. fek1000@cam.ac.uk Accepted 2015-JUL-02 by ORCHARD Human kidney cDNA Journal of the American Society of Nephrology : JASN 2015 imex curation at1b1_human Sodium/potassium-transporting ATPase subunit beta-1 Sodium/potassium-dependent ATPase subunit beta-1 ATP1B1 ATP1B protein protein human Homo sapiens Human MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS 107D3C04394F2D11 b3at_human Band 3 anion transport protein SLC4A1 AE1 DI EPB3 Anion exchange protein 1 Solute carrier family 4 member 1 protein protein human Homo sapiens Human MEELQDDYEDMMEENLEQEEYEDPDIPESQMEEPAAHDTEATATDYHTTSHPGTHKVYVELQELVMDEKNQELRWMEAARWVQLEENLGENGAWGRPHLSHLTFWSLLELRRVFTKGTVLLDLQETSLAGVANQLLDRFIFEDQIRPQDREELLRALLLKHSHAGELEALGGVKPAVLTRSGDPSQPLLPQHSSLETQLFCEQGDGGTEGHSPSGILEKIPPDSEATLVLVGRADFLEQPVLGFVRLQEAAELEAVELPVPIRFLFVLLGPEAPHIDYTQLGRAAATLMSERVFRIDAYMAQSRGELLHSLEGFLDCSLVLPPTDAPSEQALLSLVPVQRELLRRRYQSSPAKPDSSFYKGLDLNGGPDDPLQQTGQLFGGLVRDIRRRYPYYLSDITDAFSPQVLAAVIFIYFAALSPAITFGGLLGEKTRNQMGVSELLISTAVQGILFALLGAQPLLVVGFSGPLLVFEEAFFSFCETNGLEYIVGRVWIGFWLILLVVLVVAFEGSFLVRFISRYTQEIFSFLISLIFIYETFSKLIKIFQDHPLQKTYNYNVLMVPKPQGPLPNTALLSLVLMAGTFFFAMMLRKFKNSSYFPGKLRRVIGDFGVPISILIMVLVDFFIQDTYTQKLSVPDGFKVSNSSARGWVIHPLGLRSEFPIWMMFASALPALLVFILIFLESQITTLIVSKPERKMVKGSGFHLDLLLVVGMGGVAALFGMPWLSATTVRSVTHANALTVMGKASTPGAAAQIQEVKEQRISGLLVAVLVGLSILMEPILSRIPLAVLFGIFLYMGVTSLSGIQLFDRILLLFKPPKYHPDVPYVKRVKTWRMHLFTGIQIICLAVLWVVKSTPASLALPFVLILTVPLRRVLLPLIFRNVELQCLDADDAKATFDEEEGRDEYDEVAMPV Defects in SLC4A1 are the cause of elliptocytosis type 4 (EL4) [MIM:109270]. EL4 is a Rhesus-unlinked form of hereditary elliptocytosis, a genetically heterogeneous, autosomal dominant hematologic disorder. It is characterized by variable hemolytic anemia and elliptical or oval red cell shape Defects in SLC4A1 are the cause of autosomal dominant distal renal tubular acidosis (dRTA) [MIM:179800]. This disease is characterized by reduced ability to acidify urine, variable hyperchloremic hypokalemic metabolic acidosis, nephrocalcinosis, and nephrolithiasis Defects in SLC4A1 are the cause of autosomal recessive distal renal tubular acidosis (dRTA) [MIM:611590] Band 3 is the major integral glycoprotein of the erythrocyte membrane. Band 3 has two functional domains. Its integral domain mediates a 1:1 exchange of inorganic anions across the membrane, whereas its cytoplasmic domain provides binding sites for cytoskeletal proteins, glycolytic enzymes, and hemoglobin mint Defects in SLC4A1 are a cause of hereditary spherocytosis (HS) [MIM:109270]. HS is a hematologic disorder leading to chronic hemolytic anemia and characterized by numerous abnormally shaped erythrocytes which are generally spheroidal 35EC3EE7AFF27D2F at1a1_human Sodium/potassium-transporting ATPase subunit alpha-1 ATP1A1 Sodium pump subunit alpha-1 protein protein human Homo sapiens Human MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAATEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLALSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEIPFNSTNKYQLSIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY DIP protein P05023 original sequence version: 111 F3C6FDE04FB3F667 screen-1 6 9 unspecified role unspecified role bait bait c terminus sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association atp1b1-slc4a1-1 4 9 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait association association Fig 1C left panel atp1b1-slc4a1-2 4 9 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 8 unspecified role unspecified role prey prey association association Fig 1C 3rd and 4th IB I was not able to import the participant identifier separately as P05026-1 and P05026-2. P05026-1 and P05026-2 are described in Uniprot as canonical and beta-1 respectively. I could only import P05026 atp1b1-slc4a1-3 1 9 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig 1B (c and f) atp1b1-slc4a1-4 3 9 unspecified role unspecified role bait bait c-terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus b3at gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association Fig 2C upper blot The C-terminal 11 residues of SLC4A1 are essential for a complete binding site for ATP1B1, and/or form part of that site slc4a1-atp1b1-1 7 9 unspecified role unspecified role bait bait c terminus b3at_human sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association Figure 1A ae1 elisa-1 2 9 unspecified role unspecified role prey prey gst-tag AE1 gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region AE1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 41 38 direct interaction direct interaction Figure 2A atp1b1-slc4a1-5 5 9 unspecified role unspecified role neutral component neutral component gst-tag AE1 gst-tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal AE1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 45 47 direct interaction direct interaction Figure 2B