IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Kruppel-like factor 6 is a co-activator of NF-κB that mediates p65-dependent transcription of selected downstream genes. Kruppel-like factor 6 is a co-activator of NF-κB that mediates p65-dependent transcription of selected downstream genes. J. Biol. Chem. (0021-9258) 2014 imex curation Zhang Y., Lei C.Q., Hu Y.H., Xia T., Li M., Zhong B., Shu H.B. IBD - Inflammatory bowel disease The p50 and p65 expression constructs were confirmed to be of human origin by the corresponding author via e-mail. The origin of the IkB-alpha construct was based on PMID:22184009. shuh@whu.edu.cn 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Zhang Y., Lei C.Q., Hu Y.H., Xia T., Li M., Zhong B., Shu H.B. IBD - Inflammatory bowel disease The p50 and p65 expression constructs were confirmed to be of human origin by the corresponding author via e-mail. The origin of the IkB-alpha construct was based on PMID:22184009. shuh@whu.edu.cn Accepted 2015-JAN-26 by MGT J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Kruppel-like factor 6 is a co-activator of NF-κB that mediates p65-dependent transcription of selected downstream genes. Kruppel-like factor 6 is a co-activator of NF-κB that mediates p65-dependent transcription of selected downstream genes. J. Biol. Chem. (0021-9258) 2014 imex curation Zhang Y., Lei C.Q., Hu Y.H., Xia T., Li M., Zhong B., Shu H.B. IBD - Inflammatory bowel disease The p50 and p65 expression constructs were confirmed to be of human origin by the corresponding author via e-mail. The origin of the IkB-alpha construct was based on PMID:22184009. shuh@whu.edu.cn 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Zhang Y., Lei C.Q., Hu Y.H., Xia T., Li M., Zhong B., Shu H.B. IBD - Inflammatory bowel disease The p50 and p65 expression constructs were confirmed to be of human origin by the corresponding author via e-mail. The origin of the IkB-alpha construct was based on PMID:22184009. shuh@whu.edu.cn Accepted 2015-JAN-26 by MGT J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Kruppel-like factor 6 is a co-activator of NF-κB that mediates p65-dependent transcription of selected downstream genes. Kruppel-like factor 6 is a co-activator of NF-κB that mediates p65-dependent transcription of selected downstream genes. J. Biol. Chem. (0021-9258) 2014 imex curation Zhang Y., Lei C.Q., Hu Y.H., Xia T., Li M., Zhong B., Shu H.B. IBD - Inflammatory bowel disease The p50 and p65 expression constructs were confirmed to be of human origin by the corresponding author via e-mail. The origin of the IkB-alpha construct was based on PMID:22184009. shuh@whu.edu.cn 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhang Y., Lei C.Q., Hu Y.H., Xia T., Li M., Zhong B., Shu H.B. IBD - Inflammatory bowel disease The p50 and p65 expression constructs were confirmed to be of human origin by the corresponding author via e-mail. The origin of the IkB-alpha construct was based on PMID:22184009. shuh@whu.edu.cn Accepted 2015-JAN-26 by MGT J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation Kruppel-like factor 6 is a co-activator of NF-κB that mediates p65-dependent transcription of selected downstream genes. Kruppel-like factor 6 is a co-activator of NF-κB that mediates p65-dependent transcription of selected downstream genes. J. Biol. Chem. (0021-9258) 2014 imex curation Zhang Y., Lei C.Q., Hu Y.H., Xia T., Li M., Zhong B., Shu H.B. IBD - Inflammatory bowel disease The p50 and p65 expression constructs were confirmed to be of human origin by the corresponding author via e-mail. The origin of the IkB-alpha construct was based on PMID:22184009. shuh@whu.edu.cn 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hct116 Human colon carcinoma HCT116 cells hct116 Human colon carcinoma line HCT116 ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Zhang Y., Lei C.Q., Hu Y.H., Xia T., Li M., Zhong B., Shu H.B. IBD - Inflammatory bowel disease The p50 and p65 expression constructs were confirmed to be of human origin by the corresponding author via e-mail. The origin of the IkB-alpha construct was based on PMID:22184009. shuh@whu.edu.cn Accepted 2015-JAN-26 by MGT J. Biol. Chem. (0021-9258) 2014 Only protein-protein interactions imex curation ikba_human_gene NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 gene gene human Homo sapiens Human cxcl2_human_gene C-X-C motif chemokine 2 (CXCL2) human gene CXCL2 GRO2 GROB MIP2A SCYB2 gene gene human Homo sapiens Human tf65_human Transcription factor p65 Nuclear factor NF-kappa-B p65 subunit RELA NFKB3 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3 protein protein human Homo sapiens Human MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQAVAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS DIP protein Q04206 original sequence version: 170 DIP protein Q04206 original sequence version: 173 DIP protein Q04206 original sequence version: 99 DIP protein Q04206-1 original sequence version: 99 DIP protein Q04206 original sequence version: 168 DIP protein Q04206 original sequence version: 128 DIP protein Q04206 original sequence version: 131 DIP protein Q04206 original sequence version: 153 DIP protein Q04206 original sequence version: 185 DIP protein Q04206 original sequence version: 181 DIP protein Q04206 original sequence version: 183 8147A6AF9F2445C6 p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 5D027BB8EBCAA33A ccl2_human_gene C-C motif chemokine 2 CCL2 MCP1 SCYA2 HC11 Monocyte chemoattractant protein 1 Monocyte chemotactic and activating factor Monocyte chemotactic protein 1 Monocyte secretory protein JE Small-inducible cytokine A2 gene gene human Homo sapiens Human klf6_human Krueppel-like factor 6 Core promoter element-binding protein B-cell-derived protein 1 Proto-oncogene BCD1 Transcription factor Zf9 GC-rich sites-binding factor GBF KLF6 BCD1 COPEB CPBP ST12 Suppressor of tumorigenicity 12 protein protein protein human Homo sapiens Human MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLSSSVTSTPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPFKCSHCDRCFSRSDHLALHMKRHL 84294A7E6D0A0231 il8_human_gene Human IL-8 gene gene gene human Homo sapiens Human ikba_human NF-kappa-B inhibitor alpha NFKBIA IKBA MAD3 NFKBI I-kappa-B-alpha Major histocompatibility complex enhancer-binding protein MAD3 protein protein human Homo sapiens Human MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVPRGSEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCGADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTEDELPYDDCVFGGQRLTL DIP protein P25963 original sequence version: 160 DIP protein P25963 original sequence version: 157 DIP protein P25963 original sequence version: 145 DIP protein P25963 original sequence version: 170 DIP protein P25963 original sequence version: 122 DIP protein P25963 original sequence version: 128 DIP protein P25963 original sequence version: 78 DIP protein P25963 original sequence version: 121 DIP protein P25963 original sequence version: 124 088B313226786395 rela-klf6 1 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4a klf6-rela 1 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection over-expressed over expressed level over-expressed region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined n-terminal_tad sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4b, 7e Human Interleukin-1 beta (IL-1 beta) (P01584) Human Tumor necrosis factor alpha (TNF-alpha) (P01375) klf6-rela-1 3 10 unspecified role unspecified role bait bait naturally occurring naturally occurring endogenous endogenous 7 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous physical association physical association Fig. 4c, 5a Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) Human Tumor necrosis factor alpha (TNF-alpha) (P01375) (20 ng/ml) rela-klf6-1 1 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5b IkB-alpha (P25963) rela-nfkbia-12 1 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5b, 5c Co-expression of IkB-alpha dose-dependently inhibited co-precipitation of FLAG-tagged KLF6 with anti-p65 antibody. rela-klf6-2 1 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5b rela-klf6-3 1 10 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 5c klf6-ccl2 4 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait association association Fig. 6c anti-p65 siRNA Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) P01584 increases binding of Q99612 to ENSG00000108691 Q04206 increases binding of Q99612 to ENSG00000108691 klf6-cxcl2 4 10 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6c anti-p65 siRNA Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) P01584 increases binding of Q99612 to ENSG00000081041 Q04206 increases binding of Q99612 to ENSG00000081041 klf6-il8 4 10 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6a, 6c anti-p65 siRNA Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) P01584 increases binding of Q99612 to ENSG00000169429 Q04206 increases binding of Q99612 to ENSG00000169429 klf6-nfkbia 4 10 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6a, 6c anti-p65 siRNA Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) P01584 increases binding of Q99612 to ENSG00000100906 Q04206 increases binding of Q99612 to ENSG00000100906 rela-ccl2-1 4 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association Fig. 6b anti-KLF6 siRNA Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) Q99612 increases binding of Q04206 to ENSG00000108691 P01584 increases binding of Q04206 to ENSG00000108691 rela-cxcl2 4 6 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association Fig. 6b anti-KLF6 siRNA Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) Q99612 increases binding of Q04206 to ENSG00000081041 P01584 increases binding of Q04206 to ENSG00000081041 rela-il8-4 4 11 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association Fig. 6a, 6b anti-KLF6 siRNA Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) Q99612 increases binding of Q04206 to ENSG00000169429 P01584 increases binding of Q04206 to ENSG00000169429 rela-nfkbia-13 4 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 6a, 6b Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) P01584 increases binding of Q04206 to ENSG00000100906 klf6-nfkbia-1 2 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection Q99612:p.Cys265Tyr mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C Y Wed May 02 19:08:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys265tyr' Tue Jun 30 19:01:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys265Tyr' znf_c2h2/integrase_dna-bd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 7a, 7f Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) P01584 increases binding of Q99612 to ENSG00000100906 P01584 indirectly increases expression at RNA level of ENSG00000100906 klf6-cxcl2-1 2 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined znf_c2h2/integrase_dna-bd sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 7a Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) P01584 increases binding of Q99612 to ENSG00000081041 P01584 indirectly increases expression at RNA level of ENSG00000081041 Q99612 increases expression at RNA level of ENSG00000081041 klf6-il8-1 2 11 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q99612:p.Cys265Tyr mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain C Y Wed May 02 20:14:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys265tyr' Tue Jun 30 17:07:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys265Tyr' association association Fig. 7f Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) P01584 increases binding of Q99612 to ENSG00000169429 P01584 indirectly increases expression at RNA level of ENSG00000169429 Q99612 increases expression at RNA level of ENSG00000169429 rela-ccl2-2 2 7 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 7g Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) Q99612 Overexpression of human KLF6 (Q99612), but not KLF6 cys265tyr mutant, increases binding of p65 to CCL2/MCP1 promoter DNA. P01584 increases binding of Q04206 to ENSG00000108691 Q99612 increases binding of Q04206 to ENSG00000108691 P01584 indirectly increases expression at RNA level of ENSG00000108691 rela-cxcl2-1 2 6 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait association association Fig. 7g Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) Q99612 Overexpression of human KLF6 (Q99612), but not KLF6 cys265tyr mutant, increases binding of p65 to CXCL2 promoter DNA. P01584 increases binding of Q04206 to ENSG00000081041 Q99612 increases binding of Q04206 to ENSG00000081041 rela-il8-5 2 7 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 7g Human Interleukin-1 beta (IL-1 beta) (P01584) (10 ng/ml) Q99612 Overexpression of human KLF6 (Q99612), but not KLF6 cys265tyr mutant, increases binding of p65 to IL8 promoter DNA. P01584 increases binding of Q04206 to ENSG00000169429 Q99612 increases binding of Q04206 to ENSG00000169429