UniProt UniProt http://www.uniprot.org An immunogenic peptide in the A-box of HMGB1 protein reverses apoptosis-induced tolerance through RAGE receptor. An immunogenic peptide in the A-box of HMGB1 protein reverses apoptosis-induced tolerance through RAGE receptor. The Journal of biological chemistry 2014 imex curation LeBlanc PM., Doggett TA., Choi J., Hancock MA., Durocher Y., Frank F., Nagar B., Ferguson TA., Saleh M. AGER/sRAGE coordinates, tags and expression system according supplier. Coordinates for AGER/sRAGE truncated constructs are not specified and are given approximatively according UniProt domain annotaion. The expression system for HMGB1 A-box 1-67 is not specified in the publication. maya.saleh@mcgill.ca 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined LeBlanc PM., Doggett TA., Choi J., Hancock MA., Durocher Y., Frank F., Nagar B., Ferguson TA., Saleh M. AGER/sRAGE coordinates, tags and expression system according supplier. Coordinates for AGER/sRAGE truncated constructs are not specified and are given approximatively according UniProt domain annotaion. The expression system for HMGB1 A-box 1-67 is not specified in the publication. maya.saleh@mcgill.ca Accepted 2015-AUG-11 by ORCHARD The Journal of biological chemistry 2014 IMEx imex curation hmgb1_human High mobility group protein B1 HMGB1 HMG1 High mobility group protein 1 protein protein human Homo sapiens Human MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE DIP protein P09429 original sequence version: 141 8A868CF277D417B5 rage_human Advanced glycosylation end product-specific receptor AGER RAGE Receptor for advanced glycosylation end products protein protein human Homo sapiens Human MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGVILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP DIP protein Q15109 original sequence version: 157 0D584C436C30CCE7 ager-hmgb1-1 1 3 unspecified role unspecified role bait bait c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 2 unspecified role unspecified role bait bait purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 9 7 direct interaction direct interaction 4D AGER/sRAGE truncated 23-342: KD=30E-9 M AGER/sRAGE V-C1-C2 truncated 23-330..330: KD=50E-9 M AGER/sRAGE V-C1 truncated 23-224..224: KD=40E-9 M ager-hmgb1-3 1 2 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 14 12 direct interaction direct interaction 4D AGER/sRAGE truncated 23-342: KD=3E-6 M AGER/sRAGE V-C1-C2 truncated 23-330..330: KD=4E-6 M AGER/sRAGE V-C1 truncated 23-224..224: KD=3E-6 M ager-hmgb1-4 1 2 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 3 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain range range c-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 18 20 direct interaction direct interaction 4D AGER/sRAGE truncated 23-342: KD=3E-6 M AGER/sRAGE V-C1-C2 truncated 23-330..330: KD=4E-6 M AGER/sRAGE V-C1 truncated 23-224..224: KD=3E-6 M