MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it PIASy-mediated sumoylation of SREBP1c regulates hepatic lipid metabolism upon fasting signaling. PIASy-mediated sumoylation of SREBP1c regulates hepatic lipid metabolism upon fasting signaling. Molecular and cellular biology 2014 imex curation Lee GY., Jang H., Lee JH., Huh JY., Choi S., Chung J., Kim JB. jaebkim@snu.ac.kr Only protein-protein interactions imex curation mouse-hepatocyte Mouse hepatocyte hepatocyte Liver primary cell A hepatocyte is a cell of the main tissue of the liver. pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Lee GY., Jang H., Lee JH., Huh JY., Choi S., Chung J., Kim JB. jaebkim@snu.ac.kr Accepted 2015-APR-20 by LUANA Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation PIASy-mediated sumoylation of SREBP1c regulates hepatic lipid metabolism upon fasting signaling. PIASy-mediated sumoylation of SREBP1c regulates hepatic lipid metabolism upon fasting signaling. Molecular and cellular biology 2014 imex curation Lee GY., Jang H., Lee JH., Huh JY., Choi S., Chung J., Kim JB. jaebkim@snu.ac.kr Only protein-protein interactions imex curation mouse-hepatocyte Mouse hepatocyte hepatocyte Liver primary cell A hepatocyte is a cell of the main tissue of the liver. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Lee GY., Jang H., Lee JH., Huh JY., Choi S., Chung J., Kim JB. jaebkim@snu.ac.kr Accepted 2015-APR-20 by LUANA Molecular and cellular biology 2014 Only protein-protein interactions imex curation imex curation srbp1_mouse Sterol regulatory element-binding protein 1 Srebf1 Srebp1 Sterol regulatory element-binding transcription factor 1 protein protein mouse Mus musculus Mouse MDELAFGEAALEQTLAEMCELDTAVLNDIEDMLQLINNQDSDFPGLFDAPYAGGETGDTGPSSPGANSPESFSSASLASSLEAFLGGPKVTPAPLSPPPSAPAALKMYPSVSPFSPGPGIKEEPVPLTILQPAAPQPSPGTLLPPSFPAPPVQLSPAPVLGYSSLPSGFSGTLPGNTQQPPSSLPLAPAPGVLPTPALHTQVQSLASQQPLPASAAPRTNTVTSQVQQVPVVLQPHFIKADSLLLTAVKTDAGATVKTAGISTLAPGTAVQAGPLQTLVSGGTILATVPLVVDTDKLPIHRLAAGSKALGSAQSRGEKRTAHNAIEKRYRSSINDKIVELKDLVVGTEAKLNKSAVLRKAIDYIRFLQHSNQKLKQENLTLRSAHKSKSLKDLVSACGSGGGTDVSMEGMKPEVVETLTPPPSDAGSPSQSSPLSFGSRASSSGGSDSEPDSPAFEDSQVKAQRLPSHSRGMLDRSRLALCVLAFLCLTCNPLASLFGWGILTPSDATGTHRSSGRSMLEAESRDGSNWTQWLLPPLVWLANGLLVLACLALLFVYGEPVTRPHSGPAVHFWRHRKQADLDLARGDFPQAAQQLWLALQALGRPLPTSNLDLACSLLWNLIRHLLQRLWVGRWLAGQAGGLLRDRGLRKDARASARDAAVVYHKLHQLHAMGKYTGGHLAASNLALSALNLAECAGDAISMATLAEIYVAAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPLAMQWLCHPVGHRFFVDGDWAVHGAPPESLYSVAGNPVDPLAQVTRLFREHLLERALNCIAQPSPGAADGDREFSDALGYLQLLNSCSDAAGAPACSFSVSSSMAATTGPDPVAKWWASLTAVVIHWLRRDEEAAERLYPLVEHIPQVLQDTERPLPRAALYSFKAARALLDHRKVESSPASLAICEKASGYLRDSLASTPTGSSIDKAMQLLLCDLLLVARTSLWQRQQSPASVQVAHGTSNGPQASALELRGFQHDLSSLRRLAQSFRPAMRRVFLHEATARLMAGASPARTHQLLDRSLRRRAGSSGKGGTTAELEPRPTWREHTEALLLASCYLPPAFLSAPGQRMSMLAEAARTVEKLGDHRLLLDCQQMLLRLGGGTTVTSS 3D7422406E07A376 sumo1_mouse Small ubiquitin-related modifier 1 Sumo1 Smt3c Smt3h3 Ubl1 Ubiquitin-like protein SMT3C SMT3 homolog 3 Ubiquitin-homology domain protein PIC1 protein protein mouse Mus musculus Mouse MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV DIP protein P63166 original sequence version: 51 DIP protein P63166 original sequence version: 69 DIP protein P63166 original sequence version: 82 DIP protein P63166 original sequence version: 35 89BE97D2D054FB33 1-25 2 4 unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f6a 1-26 1 4 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell 3 unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell proximity proximity close-contact colocalization neighbourhood interaction f6d To explore these results at the cellular level, we investigated SREBP1c sumoylation via in situ proximity ligation assay (PLA), which allowed us to monitor protein modifications and, indirectly, physical interactions. As shown in Fig. 6D and E, SREBP1c sumoylation was detected in endogenous and exogenous SREBP1c protein from mouse primary hepatocytes and HeLa cells, respectively. Although PLA-positive signals (shown in red) indicated relatively weak SREBP1c sumoylation in primary hepatocytes, the mean number of PLA-positive red clusters per cell was augmented by forskolin, whereas these signals were decreased by H89 pretreatment (Fig. 6D and data not shown).