HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html The SseC translocon component in Salmonella enterica serovar Typhimurium is chaperoned by SscA. The SseC translocon component in Salmonella enterica serovar Typhimurium is chaperoned by SscA. BMC microbiology 2012 imex curation Cooper CA., Mulder DT., Allison SE., Pilar AV., Coombes BK. coombes@mcmaster.ca Only protein-protein interactions imex curation salts Salmonella typhimurium (strain SL1344) anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cooper CA., Mulder DT., Allison SE., Pilar AV., Coombes BK. coombes@mcmaster.ca Accepted 2015-MAR-23 by MGT BMC microbiology 2012 imex curation The SseC translocon component in Salmonella enterica serovar Typhimurium is chaperoned by SscA. The SseC translocon component in Salmonella enterica serovar Typhimurium is chaperoned by SscA. BMC microbiology 2012 imex curation Cooper CA., Mulder DT., Allison SE., Pilar AV., Coombes BK. coombes@mcmaster.ca Only protein-protein interactions imex curation salts Salmonella typhimurium (strain SL1344) anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cooper CA., Mulder DT., Allison SE., Pilar AV., Coombes BK. coombes@mcmaster.ca Accepted 2015-MAR-23 by MGT BMC microbiology 2012 imex curation a0a0h3ng86_salts sscA G1W50_11025 G1W92_07470 G1X04_02035 G1X42_07470 SL1344_1333 protein protein salts Salmonella typhimurium (strain SL1344) MKKDPTLQQAHDTMRFFRRGGSLRMLLDDDVTQPLNTLYRYATQLMEVKEFAGAARLFQLLTIYDAWSFDYWFRLGECCQAQKHWGEAIYAYGRAAQIKIDAPQAPWAAAECYLACDNVCYAIKALKAVVRICGEVSEHQILRQRAEKMLQQLSDRS 2309489848FC3101 a0a0h3nb70_salts sseC G1W50_11020 G1W92_07465 G1X04_02030 G1X42_07465 SL1344_1334 protein protein salts Salmonella typhimurium (strain SL1344) MNRIHSNSDSAAGVTALTHHHLSNVSCVSSGSLGKRQHRVNSTFGDGNAACLLSGKISLQEASNALKQLLDAVPGNHKRPSLPDFLQTNPAVLSMMMTSLILNVFGNNAQSLCQQLERATEVQNALRNKQVKEYQEQIQKAIEQEDKARKAGIFGAIFDWITGIFETVIGALKVVEGFLSGNPAEMASGVAYMAAGCAGMVKAGAETAMMCGADHDTCQAIIDVTSKIQFGCEAVALALDVFQIGRAFMATRGLSGAAAKVLDSGFGEEVVERMVGAGEAEIEELAEKFGEEVSESFSKQFEPLEREMAMANEMAEEAAEFSRNVENNMTRSAGKSFTKEGVKAMAKEAAKEALEKCVQEGGKFLLKKFRNKVLFNMFKKILYALLRDCSFKGLQAIRCATEGASQMNTGMVNTEKAKIEKKIEQLITQQRFLDFIMQQTENQKKIEQKRLEELYKGSGAALRDVLDTIDHYSSVQARIAGYRA 14C40E43A0699285 ssca-ssec-1 2 3 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey physical association physical association 2A ssca-ssec-2 1 3 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 2B