HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html Human respiratory syncytial virus N, P and M protein interactions in HEK-293T cells. Human respiratory syncytial virus N, P and M protein interactions in HEK-293T cells. Virus research 2013 imex curation Oliveira AP., Simabuco FM., Tamura RE., Guerrero MC., Ribeiro PG., Libermann TA., Zerbini LF., Ventura AM. Virus - Publications including interactions involving viral proteins Viral proteins N,P, and M, with optimized codons for expression in human cells retain >99% sequence homology with HRSV (strain A2) proteins. amventur@usp.br, amventur@gmail.com 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Oliveira AP., Simabuco FM., Tamura RE., Guerrero MC., Ribeiro PG., Libermann TA., Zerbini LF., Ventura AM. Virus - Publications including interactions involving viral proteins Viral proteins N,P, and M, with optimized codons for expression in human cells retain >99% sequence homology with HRSV (strain A2) proteins. amventur@usp.br, amventur@gmail.com Accepted 2015-NOV-09 AT 10:28 GMT AT 10:28 GMT by MGT Virus research 2013 imex curation Human respiratory syncytial virus N, P and M protein interactions in HEK-293T cells. Human respiratory syncytial virus N, P and M protein interactions in HEK-293T cells. Virus research 2013 imex curation Oliveira AP., Simabuco FM., Tamura RE., Guerrero MC., Ribeiro PG., Libermann TA., Zerbini LF., Ventura AM. Virus - Publications including interactions involving viral proteins Viral proteins N,P, and M, with optimized codons for expression in human cells retain >99% sequence homology with HRSV (strain A2) proteins. amventur@usp.br, amventur@gmail.com 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Oliveira AP., Simabuco FM., Tamura RE., Guerrero MC., Ribeiro PG., Libermann TA., Zerbini LF., Ventura AM. Virus - Publications including interactions involving viral proteins Viral proteins N,P, and M, with optimized codons for expression in human cells retain >99% sequence homology with HRSV (strain A2) proteins. amventur@usp.br, amventur@gmail.com Accepted 2015-NOV-09 AT 10:28 GMT AT 10:28 GMT by MGT Virus research 2013 imex curation Human respiratory syncytial virus N, P and M protein interactions in HEK-293T cells. Human respiratory syncytial virus N, P and M protein interactions in HEK-293T cells. Virus research 2013 imex curation Oliveira AP., Simabuco FM., Tamura RE., Guerrero MC., Ribeiro PG., Libermann TA., Zerbini LF., Ventura AM. Virus - Publications including interactions involving viral proteins Viral proteins N,P, and M, with optimized codons for expression in human cells retain >99% sequence homology with HRSV (strain A2) proteins. amventur@usp.br, amventur@gmail.com 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Oliveira AP., Simabuco FM., Tamura RE., Guerrero MC., Ribeiro PG., Libermann TA., Zerbini LF., Ventura AM. Virus - Publications including interactions involving viral proteins Viral proteins N,P, and M, with optimized codons for expression in human cells retain >99% sequence homology with HRSV (strain A2) proteins. amventur@usp.br, amventur@gmail.com Accepted 2015-NOV-09 AT 10:28 GMT AT 10:28 GMT by MGT Virus research 2013 imex curation hspa1a_hspa1b_human-1 HSPA1A_HSPA1B_human molecule set molecule set human Homo sapiens Human MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD P0DMV8,P0DMV9 mep50_human Methylosome protein 50 WDR77 MEP50 WD repeat-containing protein 77 Androgen receptor cofactor p44 p44/Mep50 HKMT1069 Nbla10071 WD45 protein protein human Homo sapiens Human MRKETPPPLVPPAAREWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE DIP protein Q9BQA1 original sequence version: 79 DIP protein Q9BQA1 original sequence version: 110 DIP protein Q9BQA1-1 original sequence version: 137 DIP protein Q9BQA1 original sequence version: 105 3D355AEC68491ECB tpm3_human Tropomyosin alpha-3 chain TPM3 Tropomyosin-3 Gamma-tropomyosin Tropomyosin-5 protein protein human Homo sapiens Human MMEAIKKKMQMLKLDKENALDRAEQAEAEQKQAEERSKQLEDELAAMQKKLKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI 99EAD24C45460A14 ncap_hrsva Nucleoprotein N Nucleocapsid protein protein protein hrsva human respiratory sy MALSKVKLNDTLNKDQLLSSSKYTIQRSTGDSIDTPNYDVQKHINKLCGMLLITEDANHKFTGLIGMLYAMSRLGREDTIKILRDAGYHVKANGVDVTTHRQDINGKEMKFEVLTLASLTTEIQINIEIESRKSYKKMLKEMGEVAPEYRHDSPDCGMIILCIAALVITKLAAGDRSGLTAVIRRANNVLKNEMKRYKGLLPKDIANSFYEVFEKHPHFIDVFVHFGIAQSSTRGGSRVEGIFAGLFMNAYGAGQVMLRWGVLAKSVKNIMLGHASVQAEMEQVVEVYEYAQKLGGEAGFYHILNNPKASLLSLTQFPHFSSVVLGNAAGLGIMGEYRGTPRNQDLYDAAKAYAEQLKENGVINYSVLDLTAEELEAIKHQLNPKDNDVEL D06E84F4F88D382B phosp_hrsva Phosphoprotein P protein protein hrsva human respiratory sy MEKFAPEFHGEDANNRATKFLESIKGKFTSPKDPKKKDSIISVNSIDIEVTKESPITSNSTIINPTNETDDTAGNKPNYQRKPLVSFKEDPTPSDNPFSKLYKETIETFDNNEEESSYSYEEINDQTNDNITARLDRIDEKLSEILGMLHTLVVASAGPTSARDGIRDAMIGLREEMIEKIRTEALMTNDRLEAMARLRNEESEKMAKDTSDEVSLNPTSEKLNNLLEGNDSDNDLSLEDF 21A9E45CA2DFD50C matrx_hrsva Matrix protein M protein M protein protein hrsva human respiratory sy METYVNKLHEGSTYTAAVQYNVLEKDDDPASLTIWVPMFQSSMPADLLIKELANVNILVKQISTPKGPSLRVMINSRSAVLAQMPSKFTICANVSLDERSKLAYDVTTPCEIKACSLTCLKSKNMLTTVKDLTMKTLNPTHDIIALCEFENIVTSKKVIIPTYLRSISVRNKDLNTLENITTTEFKNAITNAKIIPYSGLLLVITVTDNKGAFKYIKPQSQFIVDLGAYLEKESIYYVTTNWKHTATRFAIKPMED 1E70706D65416BA0 npm_human Nucleophosmin NPM1 NPM Nucleolar phosphoprotein B23 Numatrin Nucleolar protein NO38 protein protein human Homo sapiens Human MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL 620BC7BA2E4A0054 anm5_human Protein arginine N-methyltransferase 5 PRMT5 IBP72 JBP1 HRMT1L5 Shk1 kinase-binding protein 1 homolog Jak-binding protein 1 72 kDa ICln-binding protein SKB1 Histone-arginine N-methyltransferase PRMT5 protein protein human Homo sapiens Human MAAMAVGGAGGSRVSSGRDLNCVPEIADTLGAVAKQGFDFLCMPVFHPRFKREFIQEPAKNRPGPQTRSDLLLSGRDWNTLIVGKLSPWIRPDSKVEKIRRNSEAAMLQELNFGAYLGLPAFLLPLNQEDNTNLARVLTNHIHTGHHSSMFWMRVPLVAPEDLRDDIIENAPTTHTEEYSGEEKTWMWWHNFRTLCDYSKRIAVALEIGADLPSNHVIDRWLGEPIKAAILPTSIFLTNKKGFPVLSKMHQRLIFRLLKLEVQFIITGTNHHSEKEFCSYLQYLEYLSQNRPPPNAYELFAKGYEDYLQSPLQPLMDNLESQTYEVFEKDPIKYSQYQQAIYKCLLDRVPEEEKDTNVQVLMVLGAGRGPLVNASLRAAKQADRRIKLYAVEKNPNAVVTLENWQFEEWGSQVTVVSSDMREWVAPEKADIIVSELLGSFADNELSPECLDGAQHFLKDDGVSIPGEYTSFLAPISSSKLYNEVRACREKDRDPEAQFEMPYVVRLHNFHQLSAPQPCFTFSHPNRDPMIDNNRYCTLEFPVEVNTVLHGFAGYFETVLYQDITLSIRPETHSPGMFSWFPILFPIKQPITVREGQTICVRFWRCSNSKKVWYEWAVTAPVCSAIHNPTGRSYTIGL DIP protein O14744 original sequence version: 86 DIP protein O14744 original sequence version: 104 DIP protein O14744-1 original sequence version: 148 DIP protein O14744-1 original sequence version: 114 DIP protein O14744 original sequence version: 146 522E255B384F25E7 n-prmt5-1 1 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C and S3 n-wdr77-1 1 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C and S3 m-npm1-1 1 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C and S3 n-multi-1 2 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 4 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association table 1 m-multi-1 2 6 unspecified role unspecified role prey prey 10 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association table 1 p-hsp70-1 2 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association table 1 m-npm1-3 3 10 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey physical association physical association 2A and S4 n-wdr77-3 3 5 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 2A and S4 prmt5-wdr77-4 3 5 unspecified role unspecified role bait bait 11 unspecified role unspecified role prey prey physical association physical association 2B and S4G n-hs71a_human_hs71b_human-1 1 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C and S3i p-hs71a_human_hs71b_human_1-1 1 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 1C and S3i n-hs71a_human_hs71b_human_1-1 3 4 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association 2A and S4 p-hs71a_human_hs71b_human_1-2 3 4 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association 2A and S4