IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Induction of pathogenic TH17 cells by inducible salt-sensing kinase SGK1. Induction of pathogenic TH17 cells by inducible salt-sensing kinase SGK1. Nature 2013 imex curation Wu C., Yosef N., Thalhamer T., Zhu C., Xiao S., Kishi Y., Regev A., Kuchroo VK. IBD - Inflammatory bowel disease aregev@broad.mit.edu,vkuchroo@rics.harvard.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell_th17 Mouse Thelper 17 cells t-cell_th17 T-helper 17 cells ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Wu C., Yosef N., Thalhamer T., Zhu C., Xiao S., Kishi Y., Regev A., Kuchroo VK. IBD - Inflammatory bowel disease IL-23-restimulated TH17 cells aregev@broad.mit.edu,vkuchroo@rics.harvard.edu Accepted 2015-JUL-21 by ORCHARD Nature 2013 imex curation Induction of pathogenic TH17 cells by inducible salt-sensing kinase SGK1. Induction of pathogenic TH17 cells by inducible salt-sensing kinase SGK1. Nature 2013 imex curation Wu C., Yosef N., Thalhamer T., Zhu C., Xiao S., Kishi Y., Regev A., Kuchroo VK. IBD - Inflammatory bowel disease aregev@broad.mit.edu,vkuchroo@rics.harvard.edu 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell_th17 Mouse Thelper 17 cells t-cell_th17 T-helper 17 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Wu C., Yosef N., Thalhamer T., Zhu C., Xiao S., Kishi Y., Regev A., Kuchroo VK. IBD - Inflammatory bowel disease IL-23-restimulated TH17 cells aregev@broad.mit.edu,vkuchroo@rics.harvard.edu Accepted 2015-JUL-21 by ORCHARD Nature 2013 Only protein-protein interactions imex curation imex curation p51450-2 Nuclear receptor ROR-gamma RORgT Rorc Nr1f3 Rorg Thor Nuclear receptor RZR-gamma Nuclear receptor subfamily 1 group F member 3 Retinoid-related orphan receptor-gamma Thymus orphan receptor RAR-related orphan receptor C protein protein mouse Mus musculus Mouse MRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQQQQQEQVAKTPPAGSRGADTLTYTLGLSDGQLPLGASPDLPEASACPPGLLRASGSGPPYSNTLAKTEVQGASCHLEYSPERGKAEGRDSIYSTDGQLTLGRCGLRFEETRHPELGEPEQGPDSHCIPSFCSAPEVPYASLTDIEYLVQNVCKSFRETCQLRLEDLLRQRTNLFSREEVTSYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIILLTAGAMEVVLVRMCRAYNANNHTVFFEGKYGGVELFRALGCSELISSIFDFSHFLSALCFSEDEIALYTALVLINANRPGLQEKRRVEHLQYNLELAFHHHLCKTHRQGLLAKLPPKGKLRSLCSQHVEKLQIFQHLHPIVVQAAFPPLYKELFSTDVESPEGLSK Produced by alternative promoter usage. A8A1C1A08921CFB6 foxo1_mouse_gene Forkhead box protein O1 Foxo1 Fkhr Foxo1a gene gene mouse Mus musculus Mouse foxo1_mouse Forkhead box protein O1 Foxo1 Fkhr Foxo1a Forkhead box protein O1A Forkhead in rhabdomyosarcoma protein protein mouse Mus musculus Mouse MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGGAAANPDAAASLASASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHPAPPQPPPTGPLSQPPPVPPSAAAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYSKYTYGQSSMSPLPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPGVAQPNSRVLGQNVMMGPNSVMPAYGSQASHNKMMNPSSHTHPGHAQQTASVNGRTLPHVVNTMPHTSAMNRLTPVKTPLQVPLSHPMQMSALGSYSSVSSCNGYGRMGVLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG 3FF58636EA85205F il23r_mouse_gene Interleukin-23 receptor gene gene mouse Mus musculus Mouse foxo1-il23r_mouse_gene-1 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association 3F, Supp fig 6D Q9WVC6 decreases binding of Q9R1E0 to ENSMUSG00000049093. Q9WVC6 decreases expression at RNA level of ENSMUSG00000049093. Q9WVC6 decreases expression at protein level of ENSMUSG00000049093. foxo1-rorc-1 2 5 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association 3H rorc-foxo1-1 2 5 unspecified role unspecified role prey prey 3 unspecified role unspecified role bait bait physical association physical association 3Hi foxo1-foxo1-1 1 5 unspecified role unspecified role bait bait 4 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Supp fig 6A rorc-il23r_mouse_gene-1 1 6 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role bait bait association association Supp fig 6E