UniProt UniProt http://www.uniprot.org The VMP1-Beclin 1 interaction regulates autophagy induction. The VMP1-Beclin 1 interaction regulates autophagy induction. Scientific reports 2012 imex curation Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down anti tag western anti tag western blot anti tag western Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Accepted 2015-SEP-16 AT 10:41 BST AT 10:41 BST by MGT Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation - deleted EBI-11163622 molejon-2012-2, as you said is a negative exp. - missing CoIP with Bcl2, see my data-proceesing comment, cannot trace the origin. - here EBI-11163868, cannot follow as 2b is a FRET, 2e is a anti-tag CoIP but here we have cotransfected rat VMP1. Did not change anything then The VMP1-Beclin 1 interaction regulates autophagy induction. The VMP1-Beclin 1 interaction regulates autophagy induction. Scientific reports 2012 imex curation Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down western blot western blot Immuno blot Immuno blot Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Accepted 2015-SEP-16 AT 10:41 BST AT 10:41 BST by MGT Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation - deleted EBI-11163622 molejon-2012-2, as you said is a negative exp. - missing CoIP with Bcl2, see my data-proceesing comment, cannot trace the origin. - here EBI-11163868, cannot follow as 2b is a FRET, 2e is a anti-tag CoIP but here we have cotransfected rat VMP1. Did not change anything then The VMP1-Beclin 1 interaction regulates autophagy induction. The VMP1-Beclin 1 interaction regulates autophagy induction. Scientific reports 2012 imex curation Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Cells have been treated with rapamycin Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Accepted 2015-SEP-16 AT 10:41 BST AT 10:41 BST by MGT Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation - deleted EBI-11163622 molejon-2012-2, as you said is a negative exp. - missing CoIP with Bcl2, see my data-proceesing comment, cannot trace the origin. - here EBI-11163868, cannot follow as 2b is a FRET, 2e is a anti-tag CoIP but here we have cotransfected rat VMP1. Did not change anything then The VMP1-Beclin 1 interaction regulates autophagy induction. The VMP1-Beclin 1 interaction regulates autophagy induction. Scientific reports 2012 imex curation Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Accepted 2015-SEP-16 AT 10:41 BST AT 10:41 BST by MGT Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation - deleted EBI-11163622 molejon-2012-2, as you said is a negative exp. - missing CoIP with Bcl2, see my data-proceesing comment, cannot trace the origin. - here EBI-11163868, cannot follow as 2b is a FRET, 2e is a anti-tag CoIP but here we have cotransfected rat VMP1. Did not change anything then The VMP1-Beclin 1 interaction regulates autophagy induction. The VMP1-Beclin 1 interaction regulates autophagy induction. Scientific reports 2012 imex curation Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Accepted 2015-SEP-16 AT 10:41 BST AT 10:41 BST by MGT Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation - deleted EBI-11163622 molejon-2012-2, as you said is a negative exp. - missing CoIP with Bcl2, see my data-proceesing comment, cannot trace the origin. - here EBI-11163868, cannot follow as 2b is a FRET, 2e is a anti-tag CoIP but here we have cotransfected rat VMP1. Did not change anything then The VMP1-Beclin 1 interaction regulates autophagy induction. The VMP1-Beclin 1 interaction regulates autophagy induction. Scientific reports 2012 imex curation Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunostaining immunostaining Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Accepted 2015-SEP-16 AT 10:41 BST AT 10:41 BST by MGT Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation - deleted EBI-11163622 molejon-2012-2, as you said is a negative exp. - missing CoIP with Bcl2, see my data-proceesing comment, cannot trace the origin. - here EBI-11163868, cannot follow as 2b is a FRET, 2e is a anti-tag CoIP but here we have cotransfected rat VMP1. Did not change anything then The VMP1-Beclin 1 interaction regulates autophagy induction. The VMP1-Beclin 1 interaction regulates autophagy induction. Scientific reports 2012 imex curation Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Accepted 2015-SEP-16 AT 10:41 BST AT 10:41 BST by MGT Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation - deleted EBI-11163622 molejon-2012-2, as you said is a negative exp. - missing CoIP with Bcl2, see my data-proceesing comment, cannot trace the origin. - here EBI-11163868, cannot follow as 2b is a FRET, 2e is a anti-tag CoIP but here we have cotransfected rat VMP1. Did not change anything then The VMP1-Beclin 1 interaction regulates autophagy induction. The VMP1-Beclin 1 interaction regulates autophagy induction. Scientific reports 2012 imex curation Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar 21-10-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI., Molejon MI., Ropolo A., Re AL., Boggio V., Vaccaro MI. Experiments involving transfected GFP-Bcl-2 omitted as its origin cannot be established from the publication (fig 3). mvaccaro@ffyb.uba.ar mvaccaro@ ffyb.uba.ar Accepted 2015-SEP-16 AT 10:41 BST AT 10:41 BST by MGT Scientific reports 2012 Only protein-protein interactions imex curation IMEx imex curation - deleted EBI-11163622 molejon-2012-2, as you said is a negative exp. - missing CoIP with Bcl2, see my data-proceesing comment, cannot trace the origin. - here EBI-11163868, cannot follow as 2b is a FRET, 2e is a anti-tag CoIP but here we have cotransfected rat VMP1. Did not change anything then a16l1_human Autophagy-related protein 16-1 APG16-like 1 UNQ9393/PRO34307 ATG16L1 APG16L protein protein human Homo sapiens Human MSSGLRAADFPRWKRHISEQLRRRDRLQRQAFEEIILQYNKLLEKSDLHSVLAQKLQAEKHDVPNRHEISPGHDGTWNDNQLQEMAQLRIKHQEELTELHKKRGELAQLVIDLNNQMQRKDREMQMNEAKIAECLQTISDLETECLDLRTKLCDLERANQTLKDEYDALQITFTALEGKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQARLQKELAEAAKEPLPVEQDDDIEVIVDETSDHTEETSPVRAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY DIP protein Q676U5 original sequence version: 96 5A5816AE2CF03CA0 vmp1_rat Vacuole membrane protein 1 Vmp1 protein protein rat Rattus norvegicus (Rat) Rat MAENGTNCDQRRGAMSKEQHNGSFTDPSSVNEKKRRDREERQNIVLWRQPLITLQYFSLETLVVLKEWTSKLWHRQSMVVSFFLLLAALVATYYVEGAHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGAISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAETAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIVTFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHRSEAGTAQGENWLSWTFEKLVVAMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK B87BDD5E8D06D722 vmp1_human Vacuole membrane protein 1 TDC1 VMP1 TMEM49 HSPC292 Transmembrane protein 49 protein protein human Homo sapiens Human MAENGKNCDQRRVAMNKEHHNGNFTDPSSVNEKKRREREERQNIVLWRQPLITLQYFSLEILVILKEWTSKLWHRQSIVVSFLLLLAVLIATYYVEGVHQQYVQRIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYPDQIICPDEEGTEGTISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDEEYQEFEEMLEHAESAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHFLVPFWTFFGATLIGKAIIKMHIQKIFVIITFSKHIVEQMVAFIGAVPGIGPSLQKPFQEYLEAQRQKLHHKSEMGTPQGENWLSWMFEKLVVVMVCYFILSIINSMAQSYAKRIQQRLNSEEKTK E9DDE63F80143091 becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein Q14457 original sequence version: 95 DIP protein Q14457 original sequence version: 156 DIP protein Q14457 original sequence version: 122 DIP protein Q14457 original sequence version: 120 DIP protein Q14457 original sequence version: 133 DIP protein Q14457 original sequence version: 141 DIP protein Q14457 original sequence version: 106 ABF0C2DD7087473C pk3c3_human Phosphatidylinositol 3-kinase catalytic subunit type 3 PIK3C3 Phosphoinositide-3-kinase class 3 Phosphatidylinositol 3-kinase p100 subunit VPS34 hVps34 protein protein human Homo sapiens Human MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK DIP protein Q8NEB9 original sequence version: 73 DIP protein Q8NEB9 original sequence version: 78 DIP protein Q8NEB9 original sequence version: 100 DIP protein Q8NEB9 original sequence version: 113 1C03D97338E44976 becn1-vmp1-1 4 12 unspecified role unspecified role bait bait c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 1c becn1-vmp1-3 2 12 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 1e vmp1-becn1-1 1 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q14457:p.Phe123Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F A Wed May 02 16:52:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe123ala' Tue Jun 30 16:12:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe123Ala' 10 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection c-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association 1f becn1-vmp1-4 8 12 unspecified role unspecified role fluorescence donor fluorescence donor nucl transfection nucleic acid transfection nucl transfection n-terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range bh3_dom required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 10 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept c-terminus yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range proximity proximity close-contact colocalization neighbourhood interaction 2B and C becn1-vmp1-5 3 12 unspecified role unspecified role bait bait cell lysate cell lysate region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined bh3_dom required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 11 unspecified role unspecified role prey prey physical association physical association 2e becn1-vmp1-6 3 10 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey cell lysate cell lysate association association 5a becn1-pik3c3-5 5 11 unspecified role unspecified role prey prey 12 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 13 unspecified role unspecified role prey prey cell lysate cell lysate association association 5c Detected after rapamycin treatment becn1-pik3c3-6 5 11 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 13 unspecified role unspecified role prey prey cell lysate cell lysate association association 5d Detected after rapamycin treatment atg16l1-vmp1-1 6 10 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role neutral component neutral component colocalization colocalization 7a atg16l1-vmp1-2 7 10 tag fluorescence tag visualisation by fluorescence tag fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component region rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 tag fluorescence tag visualisation by fluorescence tag fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component n-terminus cfp tag cyan fluorescent protein tag CFP cyan fluorescent protein cyan fluorescent protein CFP cfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 7d Detected in ATG5-depleted cells