IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The restricted binding repertoire of Bcl-B leaves Bim as the universal BH3-only prosurvival Bcl-2 protein antagonist. The restricted binding repertoire of Bcl-B leaves Bim as the universal BH3-only prosurvival Bcl-2 protein antagonist. Cell death & disease 2011 imex curation Rautureau GJ., Yabal M., Yang H., Huang DC., Kvansakul M., Hinds MG. M.Kvansakul@latrobe.edu.au,mhinds@wehi.edu.au, 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Rautureau GJ., Yabal M., Yang H., Huang DC., Kvansakul M., Hinds MG. Full details of constructs are not given for this interaction. The details of the BIK peptide were taken from PMID: 15694340 M.Kvansakul@latrobe.edu.au,mhinds@wehi.edu.au, Accepted 2016-OCT-17 AT 10:51 BST AT 10:51 BST by PPORRAS Cell death & disease 2011 Only protein-protein interactions imex curation imex curation The restricted binding repertoire of Bcl-B leaves Bim as the universal BH3-only prosurvival Bcl-2 protein antagonist. The restricted binding repertoire of Bcl-B leaves Bim as the universal BH3-only prosurvival Bcl-2 protein antagonist. Cell death & disease 2011 imex curation Rautureau GJ., Yabal M., Yang H., Huang DC., Kvansakul M., Hinds MG. M.Kvansakul@latrobe.edu.au,mhinds@wehi.edu.au, 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro dls dynamic light scattering dls predetermined predetermined participant predetermined Rautureau GJ., Yabal M., Yang H., Huang DC., Kvansakul M., Hinds MG. M.Kvansakul@latrobe.edu.au,mhinds@wehi.edu.au, Accepted 2016-OCT-17 AT 10:51 BST AT 10:51 BST by PPORRAS Cell death & disease 2011 Only protein-protein interactions imex curation imex curation The restricted binding repertoire of Bcl-B leaves Bim as the universal BH3-only prosurvival Bcl-2 protein antagonist. The restricted binding repertoire of Bcl-B leaves Bim as the universal BH3-only prosurvival Bcl-2 protein antagonist. Cell death & disease 2011 imex curation Rautureau GJ., Yabal M., Yang H., Huang DC., Kvansakul M., Hinds MG. M.Kvansakul@latrobe.edu.au,mhinds@wehi.edu.au, 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Rautureau GJ., Yabal M., Yang H., Huang DC., Kvansakul M., Hinds MG. M.Kvansakul@latrobe.edu.au,mhinds@wehi.edu.au, Accepted 2016-OCT-17 AT 10:51 BST AT 10:51 BST by PPORRAS Cell death & disease 2011 Only protein-protein interactions imex curation imex curation The restricted binding repertoire of Bcl-B leaves Bim as the universal BH3-only prosurvival Bcl-2 protein antagonist. The restricted binding repertoire of Bcl-B leaves Bim as the universal BH3-only prosurvival Bcl-2 protein antagonist. Cell death & disease 2011 imex curation Rautureau GJ., Yabal M., Yang H., Huang DC., Kvansakul M., Hinds MG. M.Kvansakul@latrobe.edu.au,mhinds@wehi.edu.au, 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Rautureau GJ., Yabal M., Yang H., Huang DC., Kvansakul M., Hinds MG. M.Kvansakul@latrobe.edu.au,mhinds@wehi.edu.au, Accepted 2016-OCT-17 AT 10:51 BST AT 10:51 BST by PPORRAS Cell death & disease 2011 Only protein-protein interactions imex curation imex curation The restricted binding repertoire of Bcl-B leaves Bim as the universal BH3-only prosurvival Bcl-2 protein antagonist. The restricted binding repertoire of Bcl-B leaves Bim as the universal BH3-only prosurvival Bcl-2 protein antagonist. Cell death & disease 2011 imex curation Rautureau GJ., Yabal M., Yang H., Huang DC., Kvansakul M., Hinds MG. M.Kvansakul@latrobe.edu.au,mhinds@wehi.edu.au, 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Rautureau GJ., Yabal M., Yang H., Huang DC., Kvansakul M., Hinds MG. M.Kvansakul@latrobe.edu.au,mhinds@wehi.edu.au, Accepted 2016-OCT-17 AT 10:51 BST AT 10:51 BST by PPORRAS Cell death & disease 2011 Only protein-protein interactions imex curation imex curation The restricted binding repertoire of Bcl-B leaves Bim as the universal BH3-only prosurvival Bcl-2 protein antagonist. The restricted binding repertoire of Bcl-B leaves Bim as the universal BH3-only prosurvival Bcl-2 protein antagonist. Cell death & disease 2011 imex curation Rautureau GJ., Yabal M., Yang H., Huang DC., Kvansakul M., Hinds MG. M.Kvansakul@latrobe.edu.au,mhinds@wehi.edu.au, 20-Dec-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Rautureau GJ., Yabal M., Yang H., Huang DC., Kvansakul M., Hinds MG. Source of BAX, BIM taken from PMID:15901672, BIK from PMID:15694340 M.Kvansakul@latrobe.edu.au,mhinds@wehi.edu.au, Accepted 2016-OCT-17 AT 10:51 BST AT 10:51 BST by PPORRAS Cell death & disease 2011 Only protein-protein interactions imex curation imex curation b2l11_human Bcl-2-like protein 11 BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH DIP protein O43521 original sequence version: 48 DIP protein O43521-1 original sequence version: 71 DIP protein O43521 original sequence version: 132 DIP protein O43521 original sequence version: 143 D75735E469CA6997 bik_human Bcl-2-interacting killer Apoptosis inducer NBK BP4 BIP1 BIK NBK protein protein human Homo sapiens Human MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK DIP protein Q13323 original sequence version: 131 DIP protein Q13323 original sequence version: 119 89034F4443F5A136 b2l10_human Bcl-2-like protein 10 BCL2L10 BCLB Apoptosis regulator Bcl-B Anti-apoptotic protein NrH protein protein human Homo sapiens Human MVDQLRERTTMADPLRERTELLLADYLGYCAREPGTPEPAPSTPEAAVLRSAAARLRQIHRSFFSAYLGYPGNRFELVALMADSVLSDSPGPTWGRVVTLVTFAGTLLERGPLVTARWKKWGFQPRLKEQEGDVARDCQRLVALLSSRLMGQHRAWLQAQGGWDGFCHFFRTPFPLAFWRKQLVQAFLSCLLTTAFIYLWTRLL 4B46B2DC472475CB bax_human Apoptosis regulator BAX BAX BCL2L4 Bcl-2-like protein 4 protein protein human Homo sapiens Human MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG DIP protein Q07812 original sequence version: 73 DIP protein Q07812 original sequence version: 156 DIP protein Q07812 original sequence version: 92 DIP protein Q07812 original sequence version: 94 DIP protein Q07812-1 original sequence version: 93 DIP protein Q07812 original sequence version: 95 DIP protein Q07812 original sequence version: 120 DIP protein Q07812 original sequence version: 126 DIP protein Q07812 original sequence version: 143 DIP protein Q07812 original sequence version: 172 DIP protein Q07812 original sequence version: 175 6C0CDB0A7DEE4994 o43521-1 Bcl-2-like protein 11 Bim(EL) BCL2L11 BIM Bcl2-interacting mediator of cell death protein protein human Homo sapiens Human MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH D75735E469CA6997 bcl2l10-bcl2l11-1 4 BIM 7 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) Bcl-B 9 unspecified role unspecified role neutral component neutral component purified purified Q9HD36:p.[Cys30Ser;Cys138Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Fri Jul 22 10:52:15 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys20ser, cys128ser' Wed May 02 18:19:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys20ser,cys128ser' Thu Jul 11 17:41:10 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys20Ser;Cys128Ser]' Tue Jun 30 16:24:57 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys30Ser;Cys138Ser]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 14 17 direct interaction direct interaction Supp. Table 1 R working 0.196 R free 0.22 1.9A I have not used the B2L11 given in the paper as this peptide is conserved in most of the isoforms of this protein bcl2l10-bax-1 6 10 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4 bax-bcl2l10-1 6 10 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4 bcl2l10-bcl2l11-2 6 11 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4 bcl2l11-bcl2l10-1 6 11 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4 bik-bcl2l10-1 6 8 unspecified role unspecified role bait bait region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4 bcl2l10-bik-1 6 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4 bcl2l10-bcl2l11-3 1 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey direct interaction direct interaction Fig. 6 bcl2l11-bcl2l10-2 1 10 competitor competitor competitor prey prey BH3 region sufficient to bind sufficient binding region sufficient to bind range range range range chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey physical association physical association Fig. 6A The IC50 values determined by SPR for the Bax-BH3 peptide to dissociate the Bcl-B:Bim complex was 6.6uM bcl2l11-bax-1 1 8 competitor competitor competitor prey prey BH3 region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey physical association physical association Fig. 6B The IC50 values determined by SPR for the Bik-BH3 peptide to dissociate the Bcl-B:Bim complex was 113uM bcl2l10-bcl2l11-4 5 BIM 7 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) Bcl-B 9 unspecified role unspecified role neutral component neutral component purified purified Q9HD36:p.[Cys30Ser;Cys138Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Fri Jul 22 10:50:55 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys20ser, cys128ser' Wed May 02 16:34:43 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys20ser,cys128ser' Thu Jul 11 18:00:39 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys20Ser;Cys128Ser]' Tue Jun 30 19:59:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys30Ser;Cys138Ser]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 69 66 direct interaction direct interaction Supp.Fig 1 I have not used the B2L11 given in the paper as this peptide is conserved in most of the isoforms of this protein bcl2l10-bcl2l11-5 2 BIM 7 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) Bcl-B 9 unspecified role unspecified role neutral component neutral component purified purified Q9HD36:p.[Cys30Ser;Cys138Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Fri Jul 22 10:55:45 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys20ser, cys128ser' Wed May 02 17:23:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys20ser,cys128ser' Thu Jul 11 16:40:29 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys20Ser;Cys128Ser]' Tue Jun 30 18:47:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys30Ser;Cys138Ser]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp.Fig 2A I have not used the B2L11 given in the paper as this peptide is conserved in most of the isoforms of this protein bcl2l10-bcl2l11-6 3 BIM 7 unspecified role unspecified role neutral component neutral component purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) Bcl-B 9 unspecified role unspecified role neutral component neutral component Q9HD36:p.[Cys30Ser;Cys138Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain C S certain certain sequence position certain certain certain sequence position certain C S Fri Jul 22 11:05:46 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'cys20ser, cys128ser' Wed May 02 16:09:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys20ser,cys128ser' Thu Jul 11 17:57:44 BST 2019 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys20Ser;Cys128Ser]' Tue Jun 30 17:14:15 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys30Ser;Cys138Ser]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp.Fig 2B, 2C I have not used the B2L11 given in the paper as this peptide is conserved in most of the isoforms of this protein