UniProt UniProt http://www.uniprot.org Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex. Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex. The Journal of biological chemistry 2012 imex curation Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions mouse-macrophage Mus musculus macrophage macrophage Macrophage anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Wildtype, EAT2a/b-deficient peritoneal macrophages or beclin-1-GFP X beclin-1+/- macrophages have been used. Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu Accepted 2015-DEC-04 AT 14:17 GMT AT 14:17 GMT by MGT The Journal of biological chemistry 2012 imex curation (EBI-11425108): sorry got it wrong the BD is the BH3 domain and CCD the coiled coil domain, as I have no exact exp coordinates, i take ranges from Uniprot ( constructs described 19050071). atg14l i did not include as interactor with role inibitor but as antagonist as it does not show up in the respective blots Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex. Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex. The Journal of biological chemistry 2012 imex curation Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Cells have been cultured under normal or starvation conditions Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu Accepted 2015-DEC-04 AT 14:17 GMT AT 14:17 GMT by MGT The Journal of biological chemistry 2012 imex curation (EBI-11425108): sorry got it wrong the BD is the BH3 domain and CCD the coiled coil domain, as I have no exact exp coordinates, i take ranges from Uniprot ( constructs described 19050071). atg14l i did not include as interactor with role inibitor but as antagonist as it does not show up in the respective blots Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex. Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex. The Journal of biological chemistry 2012 imex curation Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu Accepted 2015-DEC-04 AT 14:17 GMT AT 14:17 GMT by MGT The Journal of biological chemistry 2012 imex curation (EBI-11425108): sorry got it wrong the BD is the BH3 domain and CCD the coiled coil domain, as I have no exact exp coordinates, i take ranges from Uniprot ( constructs described 19050071). atg14l i did not include as interactor with role inibitor but as antagonist as it does not show up in the respective blots Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex. Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex. The Journal of biological chemistry 2012 imex curation Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions human-cll_mec1 human chronic lymphocytic leukemia (CLL) MEC-1 cells Human cll_mec1 chronic lymphocytic leukemia (CLL) MEC-1 cells anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Cells have been stimulated with or without LPS Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu Accepted 2015-DEC-04 AT 14:17 GMT AT 14:17 GMT by MGT The Journal of biological chemistry 2012 imex curation (EBI-11425108): sorry got it wrong the BD is the BH3 domain and CCD the coiled coil domain, as I have no exact exp coordinates, i take ranges from Uniprot ( constructs described 19050071). atg14l i did not include as interactor with role inibitor but as antagonist as it does not show up in the respective blots Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex. Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex. The Journal of biological chemistry 2012 imex curation Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu Accepted 2015-DEC-04 AT 14:17 GMT AT 14:17 GMT by MGT The Journal of biological chemistry 2012 imex curation (EBI-11425108): sorry got it wrong the BD is the BH3 domain and CCD the coiled coil domain, as I have no exact exp coordinates, i take ranges from Uniprot ( constructs described 19050071). atg14l i did not include as interactor with role inibitor but as antagonist as it does not show up in the respective blots Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex. Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex. The Journal of biological chemistry 2012 imex curation Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Ma C., Wang N., Detre C., Wang G., O'Keeffe M., Terhorst C. Phagosomes - obtained by use of a magnet with cells incubated with E. coli-containing magnetic particles. Origin of transfected Slamf1 according sequence coordinates for mutant constructs. Y288-myc (carrying ITSM1 only) used in CoIP fig 5A cannot be reconstructed for detailed curation. Origin of transfected beclin1 wt and mutants (provided by Dr Qing Zhong) according pmid 19050071 and 16874027.. Origin of transfected HA-UVRAG (provided by Dr J.U. Jung) according pmid 18552835. Origin of transfected ATG14L and Rubicon (Dr T. Yoshimori) according pmids 19270696 and 20943950). 'Rab5' omitted as interactor in Slamf1 CoIP (fig 1C) as the used antibody is not specific. cterhors@bidmc.harvard.edu Accepted 2015-DEC-04 AT 14:17 GMT AT 14:17 GMT by MGT The Journal of biological chemistry 2012 imex curation (EBI-11425108): sorry got it wrong the BD is the BH3 domain and CCD the coiled coil domain, as I have no exact exp coordinates, i take ranges from Uniprot ( constructs described 19050071). atg14l i did not include as interactor with role inibitor but as antagonist as it does not show up in the respective blots becn1_human Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Protein GT197 BECN1 GT197 protein protein human Homo sapiens Human MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein Q14457 original sequence version: 95 DIP protein Q14457 original sequence version: 156 DIP protein Q14457 original sequence version: 122 DIP protein Q14457 original sequence version: 120 DIP protein Q14457 original sequence version: 133 DIP protein Q14457 original sequence version: 141 DIP protein Q14457 original sequence version: 106 ABF0C2DD7087473C uvrag_human UV radiation resistance-associated gene protein UVRAG p63 protein protein human Homo sapiens Human MSASASVGGPVPQPPPGPAAALPPGSAARALHVELPSQQRRLRHLRNIAARNIVNRNGHQLLDTYFTLHLCSTEKIYKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGGKENIYQLLIEWKVCLDGLKYLGQQIHARNQNEIIFGLNDGYYGAPFEHKGYSNAQKTILLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQKIGKEIEEKLRLTSTSNELKKKSECLQLKILVLQNELERQKKALGREVALLHKQQIALQDKGSAFSAEHLKLQLQKESLNELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNEHKDYFVCGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHTSSAIPVPKRQSSIFGGADVGFSGGIPSPDKGHRKRASSENERLQYKTPPPSYNSALAQPVTTVPSMGETERKITSLSSSLDTSLDFSKENKKKGEDLVGSLNGGHANVHPSQEQGEALSGHRATVNGTLLPSEQAGSASVQLPGEFHPVSEAELCCTVEQAEEIIGLEATGFASGDQLEAFNCIPVDSAVAVECDEQVLGEFEEFSRRIYALNENVSSFRRPRRSSDK DIP protein Q9P2Y5 original sequence version: 71 DIP protein Q9P2Y5 original sequence version: 102 23C4413B10F641BA rubic_human Run domain Beclin-1-interacting and cysteine-rich domain-containing protein RUBCN Beclin-1 associated RUN domain containing protein KIAA0226 protein protein human Homo sapiens Human MRPEGAGMELGGGEERLPEESRREHWQLLGNLKTTVEGLVSTNSPNVWSKYGGLERLCRDMQSILYHGLIRDQACRRQTDYWQFVKDIRWLSPHSALHVEKFISVHENDQSSADGASERAVAELWLQHSLQYHCLSAQLRPLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLLVTKSQSLTALPSSTYTPPNSYAQHSYFGSFSSLHQSVPNNGSERRSTSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSVSALARDSPLTPNEMSSSTLTSPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSSSNLFSSSSSQKPDSAASSLGDQEGGGESQLSSVLRRSSFSEGQTLTVTSGAKKSHIRSHSDTSIASRGAPESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLEKENAHFSISESLIAAIELMKCNMMSQCLEEEEVEEEDSDREIQELKQKIRLRRQQIRTKNLLPMYQEAEHGSFRVTSSSSQFSSRDSAQLSDSGSADEVDEFEIQDADIRRNTASSSKSFVSSQSFSHCFLHSTSAEAVAMGLLKQFEGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPDDGQHADIYKLRIRVRGNLEWAPPRPQIIFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMAIPSRVLRKWDFSKYYVSNFSKDLLIKIWNDPLFNVQDINSALYRKVKLLNQVRLLRVQLCHMKNMFKTCRLAKELLDSFDTVPGHLTEDLHLYSLNDLTATRKGELGPRLAELTRAGATHVERCMLCQAKGFICEFCQNEDDIIFPFELHKCRTCEECKACYHKACFKSGSCPRCERLQARREALARQSLESYLSDYEEEPAEALALEAAVLEAT 4B76166F29F5AF97 uvrag_mouse UV radiation resistance-associated protein Uvrag1 Uvrag protein protein mouse Mus musculus Mouse MSSCASLGGPVPLPPPGPSAALTSGAPARALHVELPSQQRRLRHLRNIAARNIVNRNGHQLLDTYFTLHLCDNEKIFKEFYRSEVIKNSLNPTWRSLDFGIMPDRLDTSVSCFVVKIWGGKEEAFQLLIEWKVYLDGLKYLGQQIHARNQNEIIFGLNDGYYGAPCEHKGHPNAQKNLLQVDQNCVRNSYDVFSLLRLHRAQCAIKQTQVTVQRLGKEIEEKLRLTSTSNELKKESECLRLKILVLRNELERQKKALGREVAFLHKQQMALQDKGSAFSTEHGKLQLQKDSLSELRKECTAKRELFLKTNAQLTIRCRQLLSELSYIYPIDLNENKDYFVCGVKLPNSEDFQAKDDGSIAVALGYTAHLVSMISFFLQVPLRYPIIHKGSRSTIKDNINDKLTEKEREFPLYPKGGEKLQFDYGVYLLNKNIAQLRYQHGLGTPDLRQTLPNLKNFMEHGLMVRCDRHHISNAIPVPKRQSSTFGGADGGFSAGIPSPDKVHRKRASSENERLQYKTPPPSYNSALTQPGVAMPTSGDSERKVAPLSSSLDTSLDFSKENKKAGVDLGSSVSGDHGNSDSGQEQGEALPGHLAAVNGTALPSEQAGPAGTLLPGSCHPAPSAELCCAVEQAEEIIGLEATGFTSGDQLEALSCIPVDSAVAVECDEQVLGEFEEFSRRIYALSENVSSFRRPRRSSDK 245A411198286F33 becn1_mouse Beclin-1 Coiled-coil myosin-like BCL2-interacting protein Becn1 protein protein mouse Mus musculus Mouse MEGSKASSSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEEANSGEEPFIETRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQRELKELALEEERLIQELEDVEKNRKVVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQVRYAQIQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEWNEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFFWDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFNSEEQWTKALKFMLTNLKWGLAWVSSQFYNK DIP protein O88597 original sequence version: 116 DIP protein O88597 original sequence version: 93 14623BA002E1AAEE pk3c3_human Phosphatidylinositol 3-kinase catalytic subunit type 3 PIK3C3 Phosphoinositide-3-kinase class 3 Phosphatidylinositol 3-kinase p100 subunit VPS34 hVps34 protein protein human Homo sapiens Human MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK DIP protein Q8NEB9 original sequence version: 73 DIP protein Q8NEB9 original sequence version: 78 DIP protein Q8NEB9 original sequence version: 100 DIP protein Q8NEB9 original sequence version: 113 1C03D97338E44976 pi3r4_human Phosphoinositide 3-kinase regulatory subunit 4 PI3-kinase p150 subunit Phosphoinositide 3-kinase adaptor protein PIK3R4 VPS15 protein protein human Homo sapiens Human MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDPTLPLTSYKQELEELKIRLNSAQNCLPFQKASEKASEKAAMLFRQYVRDNLYDRISTRPFLNNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNPADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRTRGELKRAMDIFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDHSIRELVTQMIHREPDKRLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGHDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRLSVEILLDRITPYLLHFSNDSVPRVRAEALRTLTKVLALVKEVPRNDINIYPEYILPGIAHLAQDDATIVRLAYAENIALLAETALRFLELVQLKNLNMENDPNNEEIDEVTHPNGNYDTELQALHEMVQQKVVTLLSDPENIVKQTLMENGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDSIVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALYALTCMCQLGLLQKPHVYEFASDIAPFLCHPNLWIRYGAVGFITVVARQISTADVYCKLMPYLDPYITQPIIQIERKLVLLSVLKEPVSRSIFDYALRSKDITSLFRHLHMRQKKRNGSLPDCPPPEDPAIAQLLKKLLSQGMTEEEEDKLLALKDFMMKSNKAKANIVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEPDDKRARKHVKQDSNVNEEWKSMFGSLDPPNMPQALPKGSDQEVIQTGKPPRSESSAGICVPLSTSSQVPEVTTVQNKKPVIPVLSSTILPSTYQIRITTCKTELQQLIQQKREQCNAERIAKQMMENAEWESKPPPPGWRPKGLLVAHLHEHKSAVNRIRVSDEHSLFATCSNDGTVKIWNSQKMEGKTTTTRSILTYSRIGGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSPKIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLKSGLITSFAVDIHQCWLCIGTSSGTMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWVIAAVQGNNEVSMWDMETGDRRFTLWASSAPPLSELQPSPHSVHGIYCSPADGNPILLTAGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK DIP protein Q99570 original sequence version: 91 5B402175265B21F7 pk3c3_mouse Phosphatidylinositol 3-kinase catalytic subunit type 3 Vps34 Pik3c3 Phosphoinositide-3-kinase class 3 protein protein mouse Mus musculus Mouse MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGSAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTRTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNATTRDQLNIIVSYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDVEDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKKDSQTSASESLSNSGVSSGDIDSSQIITNPLPPVASPPPASKAKEVSDGENLEQDLCTFLISRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRSLLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVKIRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRKENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSETGPYGISAEVMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLNKEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVKKVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK DIP protein Q6PF93 original sequence version: 92 80E8EF9EF3AF74D7 slaf1_mouse Signaling lymphocytic activation molecule SLAM family member 1 Slam Slamf1 protein protein mouse Mus musculus Mouse MDPKGSLSWRILLFLSLAFELSYGTGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSPWMQYTLVPLGVVIIFILVFTAIIMMKRQGKSNHCQPPVEEKSLTIYAQVQKSGPQEKKLHDALTDQDPCTTIYVAATEPAPESVQEPNPTTVYASVTLPES High-affinity self-ligand important in bidirectional T-cell to B-cell stimulation. SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates mint 7980470157E834C4 slaf1_human Signaling lymphocytic activation molecule SLAMF1 SLAM family member 1 SLAM CDw150 IPO-3 protein protein human Homo sapiens Human MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAVYAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQDPCTTIYVAATEPVPESVQETNSITVYASVTLPES DIP protein Q13291 original sequence version: 151 DIP protein Q13291 original sequence version: 110 DIP protein Q13291 original sequence version: 106 DIP protein Q13291 original sequence version: 112 BFB0F27EA31D8C04 bakor_human Beclin 1-associated autophagy-related key regulator KIAA0831 Autophagy-related protein 14-like protein ATG14 ATG14L protein protein human Homo sapiens Human MASPSGKGARALEAPGCGPRPLARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCVQSGDFVYFDGRDRERFIDKKERLSRLKSKQEEFQKEVLKAMEGKWITDQLRWKIMSCKMRIEQLKQTICKGNEEMEKNSEGLLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKKTIDLRSHYERLANLRRSHILELTSVIFPIEEVKTGVRDPADVSSESDSAMTSSTVSKLAEARRTTYLSGRWVCDDHNGDTSISITGPWISLPNNGDYSAYYSWVEEKKTTQGPDMEQSNPAYTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGENLSKQKFTRAVKKLNANILYLCFSQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESMEFVDPGVAGESDESGDERVSDEETDLGTDWENLPSPRFCDIPSQSVEVSQSQSTQASPPIASSSAGGMISSAAASVTSWFKAYTGHR DIP protein Q6ZNE5 original sequence version: 50 DIP protein Q6ZNE5 original sequence version: 103 DIP protein Q6ZNE5 original sequence version: 73 A3EAB0580077D7A6 becn1-pik3c3-7 1 15 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey association association 1 A/B Also observed in EAT2a/b deficient macrophages slamf1-becn1-1 1 15 unspecified role unspecified role bait bait 10 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 11 unspecified role unspecified role prey prey nucl transformation nucleic acid transformation nucl transformation n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 11 unspecified role unspecified role prey prey association association 1B Observed in beclin-1-GFP X beclin-1+/- macrophages becn1-pik3c3-8 6 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined A HA-tagged Slamf1-tailless construct (missing the cytoplasmic domain aa 266-343 according UniProt) does not interact 10 unspecified role unspecified role unspecified role unspecified role 11 unspecified role unspecified role unspecified role unspecified role 14 unspecified role unspecified role unspecified role unspecified role association association 1C Rab5 also detected by use of unspecific antibody; not mapped to UniProt. This interaction did not occur when using an HA tagged "Slamf1 tailless" construct as Bait rather than the full-length molecule;the amino acids in this "cytoplasmic tail" construct are not given, but is in the region of aas 226-242 of Slamf1. slamf1-becn1-2 4 8 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey 16 unspecified role unspecified role bait bait association association 3a Observed in LPS-stimulated or not stimulated cells. slamf1-becn1-4 2 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 8 unspecified role unspecified role prey prey 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association 3b Observed in LPS-stimulated or not stimulated cells. uvrag-becn1-8 2 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 8 unspecified role unspecified role bait bait 12 unspecified role unspecified role prey prey 7 unspecified role unspecified role prey prey association association 3b Observed in LPS-stimulated or not stimulated cells. slamf1-becn1-3 5 15 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 13 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range a VPS34-VPS15 fusion construct has been transfected 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range a VPS34-VPS15 fusion construct has been transfected 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association 4A (8) atg14-becn1-18 5 17 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range a VPS34-VPS15 fusion construct has been transfected 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range a VPS34-VPS15 fusion construct has been transfected 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association 4B (8) Transfected Slamf1 not precipitated kiaa0226-becn1-1 5 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association 4C (7+8) Transfected Slamf1 was not precipitated In Lane 7 there is a band visible for Beclin;possibly endogenous. slamf1-becn1-5 2 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Slamf1 constructs with single mutations tyr288phe, tyr315phe and tyr335phe interact almost equally as the wildtype. A Slamf1 construct (Y288-myc) containing only ITSM 1 (stated to resemble in such Slamf1 isoform short) interacts. A HA-tagged Slamf1-tailless construct (missing the cytoplasmic domain aa 266-343 according UniProt) does not interact 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 5 A/B becn1-slamf1-1 3 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region_containing_bd_and ccd_domains sufficient to bind sufficient binding region sufficient to bind range range range range physical association physical association 6A slamf1-becn1-6 3 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 13 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range a VPS34-VPS15 fusion construct has been transfected 12 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range a VPS34-VPS15 fusion construct has been transfected 7 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association 4A (4) and 4B (4) slamf1-becn1-7 3 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association 4A (5) and 4C (4) Presence of EGFP-Rubicon does not change the association slamf1-uvrag-1 3 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 4A (3) and 4C (3) slamf1-becn1-8 2 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 4A, (2) and 4B (2), 4C (2) ATG14L-GFP Presence of EGFP-Rubicon does not change the association slamf1-pik3c3-2 3 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 13 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range a VPS34-VPS15 fusion construct has been transfected 12 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range a VPS34-VPS15 fusion construct has been transfected association association 4A (1) and 4B (3) ATG14L-GFP atg14-becn1-19 5 17 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection 12 unspecified role unspecified role prey prey association association 4B (6) Transfected Slamf1 not precipitated atg14-pik3c3-3 5 17 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 unspecified role unspecified role prey prey physical association physical association 4B (5) Transfected Slamf1 not precipitated atg14-pik3c3-4 5 17 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range a VPS34-VPS15 fusion construct has been transfected 12 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range a VPS34-VPS15 fusion construct has been transfected association association 4B (7) kiaa0226-becn1-2 5 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association 4C (5) Transfected Slamf1 was not precipitated kiaa0226-becn1-3 5 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 4C (6) Transfected Slamf1 was not precipitated slamf1-becn1-10 3 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection 8 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection c-terminus v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range a VPS34-VPS15 fusion construct has been transfected 12 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection n-terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range a VPS34-VPS15 fusion construct has been transfected 7 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection association association 4A (6) slamf1-becn1-11 2 15 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection Q9QUM4:p.[Tyr288Phe;Tyr315Phe] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Fri Jul 22 11:08:13 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr288phe_tyr315phe' Wed May 02 14:31:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr288phe,tyr315phe' Tue Jun 30 18:06:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr288Phe;Tyr315Phe]' Q9QUM4:p.[Tyr288Phe;Tyr335Phe] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Fri Jul 22 10:51:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr288phe_tyr335phe' Wed May 02 15:37:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr288phe,tyr335phe' Tue Jun 30 19:35:26 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr288Phe;Tyr335Phe]' Q9QUM4:p.[Tyr315Phe;Tyr335Phe] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y F certain certain sequence position certain certain certain sequence position certain Y F Fri Jul 22 11:12:37 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr315phe_tyr335phe' Wed May 02 17:17:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr315phe,tyr335phe' Tue Jun 30 17:27:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Tyr315Phe;Tyr335Phe]' Slamf1 constructs with single mutations tyr288phe, tyr315phe and tyr335phe interact almost equally as the wildtype. A Slamf1 construct (Y288-myc) containing only ITSM 1 (stated to resemble in such Slamf1 isoform short) interacts. A HA-tagged Slamf1-tailless construct (missing the cytoplasmic domain aa 266-343 according UniProt) does not interact 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association 5C