IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Transcription factors Foxo3a and Foxo1 couple the E3 ligase Cbl-b to the induction of Foxp3 expression in induced regulatory T cells. Transcription factors Foxo3a and Foxo1 couple the E3 ligase Cbl-b to the induction of Foxp3 expression in induced regulatory T cells. The Journal of experimental medicine 2010 imex curation Harada Y., Harada Y., Elly C., Ying G., Paik JH., DePinho RA., Liu YC. IBD - Inflammatory bowel disease yuncail@liai.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Harada Y., Harada Y., Elly C., Ying G., Paik JH., DePinho RA., Liu YC. IBD - Inflammatory bowel disease as far as I can see-the M+M probe sequence bears no relationship to that given in Fig 5B and that given in text under fig 5 - but I have taken the probe sequence from Fig 5B - not methods section one. Where used, mouse T cell lysates from naive CD4 T cells stimulated with anti-CD3, anti-CD28, and TGF-beta were mixed with biotinylated DNA probes. The Foxo3a "H212R" mutant had been entered as H211R as there is no histidine residue at position 212 according to UniProt Q9WVH4. DNA probe sequences have been taken from Figure 5B. yuncail@liai.org Accepted 2015-NOV-19 AT 10:59 GMT AT 10:59 GMT by ORCHARD The Journal of experimental medicine 2010 Only protein-protein interactions imex curation imex curation I have altered the 2 Causality statements to include term "indirectly". Transcription factors Foxo3a and Foxo1 couple the E3 ligase Cbl-b to the induction of Foxp3 expression in induced regulatory T cells. Transcription factors Foxo3a and Foxo1 couple the E3 ligase Cbl-b to the induction of Foxp3 expression in induced regulatory T cells. The Journal of experimental medicine 2010 imex curation Harada Y., Harada Y., Elly C., Ying G., Paik JH., DePinho RA., Liu YC. IBD - Inflammatory bowel disease yuncail@liai.org 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes ch-ip chromatin immunoprecipitation assay ch-ip q-pcr quantitative pcr q-pcr Harada Y., Harada Y., Elly C., Ying G., Paik JH., DePinho RA., Liu YC. IBD - Inflammatory bowel disease Mouse T cell lysates from naive CD4 T cells stimulated with anti-CD3, anti-CD28, and TGF-beta. yuncail@liai.org Accepted 2015-NOV-19 AT 10:59 GMT AT 10:59 GMT by ORCHARD The Journal of experimental medicine 2010 Only protein-protein interactions imex curation imex curation I have altered the 2 Causality statements to include term "indirectly". foxo1_mouse Forkhead box protein O1 Foxo1 Fkhr Foxo1a Forkhead box protein O1A Forkhead in rhabdomyosarcoma protein protein mouse Mus musculus Mouse MAEAPQVVETDPDFEPLPRQRSCTWPLPRPEFNQSNSTTSSPAPSGGAAANPDAAASLASASAVSTDFMSNLSLLEESEDFARAPGCVAVAAAAAASRGLCGDFQGPEAGCVHPAPPQPPPTGPLSQPPPVPPSAAAAAGPLAGQPRKTSSSRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGPGDSPGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSLVYPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGSMMQQTPCYSFAPPNTSLNSPSPNYSKYTYGQSSMSPLPQMPMQTLQDSKSSYGGLNQYNCAPGLLKELLTSDSPPHNDIMSPVDPGVAQPNSRVLGQNVMMGPNSVMPAYGSQASHNKMMNPSSHTHPGHAQQTASVNGRTLPHVVNTMPHTSAMNRLTPVKTPLQVPLSHPMQMSALGSYSSVSSCNGYGRMGVLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG 3FF58636EA85205F foxo3_mouse Forkhead box protein O3 Foxo3 Fkhr2 Foxo3a protein protein mouse Mus musculus Mouse MAEAPASPVPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEEDDDEDDEDGGGRASSAMVIGGGVSSTLGSGLLLEDSAMLLAPGGQDLGSGPASAAGALSGGTPTQLQPQQPLPQPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQAAPESADDSPSQLSKWPGSPTSRSSDELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDGPLSPMLYSSSASLSPSVSKPCTVELPRLTDMAGTMNLNDGLAENLMDDLLDNIALPPSQPSPPGGLMQRGSSFPYTAKSSGLGSPTGSFNSTVFGPSSLNSLRQSPMQTIQENRPATFSSVSHYGNQTLQDLLASDSLSHSDVMMTQSDPLMSQASTAVSAQNARRNVMLRNDPMMSFAAQPTQGSLVNQNLLHHQHQTQGALGGSRALSNSVSNMGLSDSSSLGSAKHQQQSPASQSMQTLSDSLSGSSLYSASANLPVMGHDKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFTGAKQASSQSWVPG EC218D9BA0C1DAC5 foxp3_proximal_promoter_foxo_binding _site_probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid mouse Mus musculus Mouse GTTGTTTTT foxp3_mouse_gene Forkhead box protein P3 Foxp3 gene gene mouse Mus musculus Mouse foxp3_proximal_promoter_foxo_binding _site_probe-foxo3-1 1 5 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain T_T_T5-7G_G_G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain TTT GGG chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role prey prey mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes physical association physical association 5 C foxp3_proximal_promoter_foxo_binding _site_probe-foxo3-2 1 5 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain T_T_T5-7G_G_G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain TTT GGG chemical synthesis Chemical synthesis (Chemical synthesis) 4 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey undefined mutation mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:44:10 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'his211arg' region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. physical association physical association 5 D foxo3-foxp3-1 2 6 unspecified role unspecified role prey prey promoter_region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role bait bait physical association physical association 5 E Q9WVH4 increases expression at protein level of ENSMUSG00000039521 Q9R1E0 increases expression at protein level of ENSMUSG00000039521 causality from figs: 5F,6,1,3B,4. CHEBI:65329 indirectly increases expression at protein level of ENSMUSG00000039521 Q3TTA7 indirectly increases expression at protein level of ENSMUSG00000039521 foxp3_proximal_promoter_foxo_binding _site_probe-foxo1-1 1 3 unspecified role unspecified role prey prey mouse-t-cell Mouse T cell t-cell Peripheral blood T-lymphocytes 5 unspecified role unspecified role bait bait 5-prime biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain T_T_T5-7G_G_G mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain TTT GGG chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association 6F