IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Neuronal nicotinic acetylcholine receptors expressed in Xenopus oocytes have a pentameric quaternary structure. Neuronal nicotinic acetylcholine receptors expressed in Xenopus oocytes have a pentameric quaternary structure. The Journal of biological chemistry 1991 imex curation Anand R., Conroy WG., Schoepfer R., Whiting P., Lindstrom J. jslkk@mail.med.upenn.edu Only protein-protein interactions imex curation xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Anand R., Conroy WG., Schoepfer R., Whiting P., Lindstrom J. jslkk@mail.med.upenn.edu Accepted 2015-APR-23 by MGT The Journal of biological chemistry 1991 Only protein-protein interactions imex curation imex curation Neuronal nicotinic acetylcholine receptors expressed in Xenopus oocytes have a pentameric quaternary structure. Neuronal nicotinic acetylcholine receptors expressed in Xenopus oocytes have a pentameric quaternary structure. The Journal of biological chemistry 1991 imex curation Anand R., Conroy WG., Schoepfer R., Whiting P., Lindstrom J. jslkk@mail.med.upenn.edu Only protein-protein interactions imex curation xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip weight identificat confirmation by molecular weight weight identificat Anand R., Conroy WG., Schoepfer R., Whiting P., Lindstrom J. Protein complexes were isolated on a sucrose gradient and affinity purified with either anti-beta2 (Fig. 4, lane 2) or anti-alpha1 (Fig. 5). Stoichiometry was determined by liquid scintillation counting of the [35S]methionine signature of each band normalised to the number of methionines in each protein. The Torpedo protein constructs were supplied by Toni Claudio (see Methods) who used Torpedo californica in PMID:2335568. jslkk@mail.med.upenn.edu Accepted 2015-APR-23 by MGT The Journal of biological chemistry 1991 Only protein-protein interactions imex curation imex curation Neuronal nicotinic acetylcholine receptors expressed in Xenopus oocytes have a pentameric quaternary structure. Neuronal nicotinic acetylcholine receptors expressed in Xenopus oocytes have a pentameric quaternary structure. The Journal of biological chemistry 1991 imex curation Anand R., Conroy WG., Schoepfer R., Whiting P., Lindstrom J. jslkk@mail.med.upenn.edu Only protein-protein interactions imex curation xenla-oocyte Xenopus laevis oocyte Oocyte anti bait coip anti bait coimmunoprecipitation anti bait coip weight identificat confirmation by molecular weight weight identificat Anand R., Conroy WG., Schoepfer R., Whiting P., Lindstrom J. Proteins were treated with glycopetidase F prior to loading on SDS-PAGE to remove suspected heterogeneous glycosylation sites (cf lanes 1 and 2). jslkk@mail.med.upenn.edu Accepted 2015-APR-23 by MGT The Journal of biological chemistry 1991 Only protein-protein interactions imex curation imex curation Neuronal nicotinic acetylcholine receptors expressed in Xenopus oocytes have a pentameric quaternary structure. Neuronal nicotinic acetylcholine receptors expressed in Xenopus oocytes have a pentameric quaternary structure. The Journal of biological chemistry 1991 imex curation Anand R., Conroy WG., Schoepfer R., Whiting P., Lindstrom J. jslkk@mail.med.upenn.edu Only protein-protein interactions imex curation xenla-oocyte Xenopus laevis oocyte Oocyte pull down pull down weight identificat confirmation by molecular weight weight identificat Anand R., Conroy WG., Schoepfer R., Whiting P., Lindstrom J. Protein complexes were isolated on a sucrose gradient and affinity purified with bromo-acetylcholine (BAC)-affinity gel. BAC is a ligand of acetylcholine receptors that binds at the interface of alpha and beta subunits. Stoichiometry was determined by liquid scintillation counting of the [35S]methionine signature of each band normalised to the number of methionines in each protein. jslkk@mail.med.upenn.edu Accepted 2015-APR-23 by MGT The Journal of biological chemistry 1991 Only protein-protein interactions imex curation imex curation acha4_chick Neuronal acetylcholine receptor subunit alpha-4 CHRNA4 protein protein chick Gallus gallus (Chicken) Chicken MGFLVSKGNLLLLLCASIFPAFGHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPQEYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRIKWMPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLVSMHSHVDQLDYWESGEWVIINAVGNYNSKKYECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPRTHTMPDWVRRVFLDIVPRLLFMKRPSTVKDNCKKLIESMHKLTNSPRLWSETDMEPNFTTSSSPSPQSNEPSPTSSFCAHLEEPAKPMCKSPSGQYSMLHPEPPQVTCSSPKPSCHPLSDTQTTSISKGRSLSVQQMYSPNKTEEGSIRCRSRSIQYCYLQEDSSQTNGHSSASPASQRCHLNEEQPQHKPHQCKCKCRKGEAAGTPTQGSKSHSNKGEHLVLMSPALKLAVEGVHYIADHLRAEDADFSVKEDWKYVAMVIDRIFLWMFIIVCLLGTVGLFLPPWLAGMI 290B035893D6485A acha_tetcf Acetylcholine receptor subunit alpha CHRNA1 protein protein tetcf Torpedo californica (Pacific electric ray) Pacific electric ray Torpedo californica MILCSYWHVGLVLLLFSCCGLVLGSEHETRLVANLLENYNKVIRPVEHHTHFVDITVGLQLIQLISVDEVNQIVETNVRLRQQWIDVRLRWNPADYGGIKKIRLPSDDVWLPDLVLYNNADGDFAIVHMTKLLLDYTGKIMWTPPAIFKSYCEIIVTHFPFDQQNCTMKLGIWTYDGTKVSISPESDRPDLSTFMESGEWVMKDYRGWKHWVYYTCCPDTPYLDITYHFIMQRIPLYFVVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMIFVISSIIITVVVINTHHRSPSTHTMPQWVRKIFIDTIPNVMFFSTMKRASKEKQENKIFADDIDISDISGKQVTGEVIFQTPLIKNPDVKSAIEGVKYIAEHMKSDEESSNAAEEWKYVAMVIDHILLCVFMLICIIGTVSVFAGRLIELSQEG 398C86C9309AF0D8 acha_human Acetylcholine receptor subunit alpha CHRNA1 ACHRA CHNRA protein protein human Homo sapiens Human MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSAIEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQQG 8B307AD69B91A28B achd_tetcf Acetylcholine receptor subunit delta chrnd protein protein tetcf Torpedo californica (Pacific electric ray) Pacific electric ray Torpedo californica MGNIHFVYLLISCLYYSGCSGVNEEERLINDLLIVNKYNKHVRPVKHNNEVVNIALSLTLSNLISLKETDETLTSNVWMDHAWYDHRLTWNASEYSDISILRLPPELVWIPDIVLQNNNDGQYHVAYFCNVLVRPNGYVTWLPPAIFRSSCPINVLYFPFDWQNCSLKFTALNYDANEITMDLMTDTIDGKDYPIEWIIIDPEAFTENGEWEIIHKPAKKNIYPDKFPNGTNYQDVTFYLIIRRKPLFYVINFITPCVLISFLASLAFYLPAESGEKMSTAISVLLAQAVFLLLTSQRLPETALAVPLIGKYLMFIMSLVTGVIVNCGIVLNFHFRTPSTHVLSTRVKQIFLEKLPRILHMSRADESEQPDWQNDLKLRRSSSVGYISKAQEYFNIKSRSELMFEKQSERHGLVPRVTPRIGFGNNNENIAASDQLHDEIKSGIDSTNYIVKQIKEKNAYDEEVGNWNLVGQTIDRLSMFIITPVMVLGTIFIFVMGNFNHPPAKPFEGDPFDYSSDHPRCA mint 568CF9C3D3E91E28 achg_tetcf Acetylcholine receptor subunit gamma CHRNG protein protein tetcf Torpedo californica (Pacific electric ray) Pacific electric ray Torpedo californica MVLTLLLIICLALEVRSENEEGRLIEKLLGDYDKRIIPAKTLDHIIDVTLKLTLTNLISLNEKEEALTTNVWIEIQWNDYRLSWNTSEYEGIDLVRIPSELLWLPDVVLENNVDGQFEVAYYANVLVYNDGSMYWLPPAIYRSTCPIAVTYFPFDWQNCSLVFRSQTYNAHEVNLQLSAEEGEAVEWIHIDPEDFTENGEWTIRHRPAKKNYNWQLTKDDTDFQEIIFFLIIQRKPLFYIINIIAPCVLISSLVVLVYFLPAQAGGQKCTLSISVLLAQTIFLFLIAQKVPETSLNVPLIGKYLIFVMFVSMLIVMNCVIVLNVSLRTPNTHSLSEKIKHLFLGFLPKYLGMQLEPSEETPEKPQPRRRSSFGIMIKAEEYILKKPRSELMFEEQKDRHGLKRVNKMTSDIDIGTTVDLYKDLANFAPEIKSCVEACNFIAKSTKEQNDSGSENENWVLIGKVIDKACFWIALLLFSIGTLAIFLTGHFNQVPEFPFPGDPRKYVP 48A5F5D82BC66C9D achb2_chick Neuronal acetylcholine receptor subunit beta-2 CHRNB2 Neuronal acetylcholine receptor non-alpha-1 chain protein protein chick Gallus gallus (Chicken) Chicken MALLRVLCLLAALRRSLCTDTEERLVEYLLDPTRYNKLIRPATNGSQLVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVISYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCILITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMPPWVRTLFLRKLPALLFMKQPQQNCARQRLRQRRQTQERAAAATLFLRAGARACACYANPGAAKAEGLNGYRERQGQGPDPPAPCGCGLEEAVEGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTVGMFLQPLFQNYATNSLLQLGQGTPTSK 984331E8A76D9750 achb_tetcf Acetylcholine receptor subunit beta CHRNB1 protein protein tetcf Torpedo californica (Pacific electric ray) Pacific electric ray Torpedo californica MENVRRMALGLVVMMALALSGVGASVMEDTLLSVLFETYNPKVRPAQTVGDKVTVRVGLTLTNLLILNEKIEEMTTNVFLNLAWTDYRLQWDPAAYEGIKDLRIPSSDVWQPDIVLMNNNDGSFEITLHVNVLVQHTGAVSWQPSAIYRSSCTIKVMYFPFDWQNCTMVFKSYTYDTSEVTLQHALDAKGEREVKEIVINKDAFTENGQWSIEHKPSRKNWRSDDPSYEDVTFYLIIQRKPLFYIVYTIIPCILISILAILVFYLPPDAGEKMSLSISALLAVTVFLLLLADKVPETSLSVPIIIRYLMFIMILVAFSVILSVVVLNLHHRSPNTHTMPNWIRQIFIETLPPFLWIQRPVTTPSPDSKPTIISRANDEYFIRKPAGDFVCPVDNARVAVQPERLFSEMKWHLNGLTQPVTLPQDLKEAVEAIKYIAEQLESASEFDDLKKDWQYVAMVADRLFLYVFFVICSIGTFSIFLDASHNVPPDNPFA 4E145192584D8F5F chrnb2-chrna4-4 1 5 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait physical association physical association Fig. 1 chrnb2-chrna4-5 3 5 unspecified role unspecified role prey prey [35]S-radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait [35]S-radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 2 chrnb2-chrna4-6 2 5 unspecified role unspecified role prey prey [35]S-radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role bait bait [35]S-radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4 (lane 2), Table 1 Protein complexes were isolated on a sucrose gradient and affinity purified with anti-beta2. Stoichiometry was determined by liquid scintillation counting of the [35S]methionine signature of each band normalised to the number of methionines in each protein. chrnb2-chrna4-7 4 5 unspecified role unspecified role unspecified role unspecified role [35]S-radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 10 unspecified role unspecified role unspecified role unspecified role [35]S-radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 4 (lane 1), Table 1 chrna1-chrnb1-1 2 8 unspecified role unspecified role prey prey [35]S-radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey [35]S-radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey [35]S-radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role bait bait [35]S-radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5 (lane 1) Protein complexes were isolated on a sucrose gradient and affinity purified with anti-alpha1. Stoichiometry was determined by liquid scintillation counting of the [35S]methionine signature of each band normalised to the number of methionines in each protein. chrna1-chrnb1-2 2 8 unspecified role unspecified role prey prey [35]S-radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 9 unspecified role unspecified role prey prey [35]S-radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 11 unspecified role unspecified role prey prey [35]S-radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait [35]S-radiolabel 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 5 (lane 2) Protein complexes were isolated on a sucrose gradient and affinity purified with anti-alpha1. Stoichiometry was determined by liquid scintillation counting of the [35S]methionine signature of each band normalised to the number of methionines in each protein.