UniProt UniProt http://www.uniprot.org Phosphoinositide-dependent regulation of VAN3 ARF-GAP localization and activity essential for vascular tissue continuity in plants. Phosphoinositide-dependent regulation of VAN3 ARF-GAP localization and activity essential for vascular tissue continuity in plants. Development (Cambridge, England) 2009 imex curation Naramoto S., Sawa S., Koizumi K., Uemura T., Ueda T., Friml J., Nakano A., Fukuda H. sanar@psb.vib-ugent.be Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Naramoto S., Sawa S., Koizumi K., Uemura T., Ueda T., Friml J., Nakano A., Fukuda H. sanar@psb.vib-ugent.be Accepted 2015-MAY-07 by ORCHARD Development (Cambridge, England) 2009 imex curation Phosphoinositide-dependent regulation of VAN3 ARF-GAP localization and activity essential for vascular tissue continuity in plants. Phosphoinositide-dependent regulation of VAN3 ARF-GAP localization and activity essential for vascular tissue continuity in plants. Development (Cambridge, England) 2009 imex curation Naramoto S., Sawa S., Koizumi K., Uemura T., Ueda T., Friml J., Nakano A., Fukuda H. sanar@psb.vib-ugent.be Only protein-protein interactions tobac-leaf Nicotiana tabacum (tobacco) leaf leaf leaf fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Naramoto S., Sawa S., Koizumi K., Uemura T., Ueda T., Friml J., Nakano A., Fukuda H. sanar@psb.vib-ugent.be Accepted 2015-MAY-07 by ORCHARD Development (Cambridge, England) 2009 imex curation Phosphoinositide-dependent regulation of VAN3 ARF-GAP localization and activity essential for vascular tissue continuity in plants. Phosphoinositide-dependent regulation of VAN3 ARF-GAP localization and activity essential for vascular tissue continuity in plants. Development (Cambridge, England) 2009 imex curation Naramoto S., Sawa S., Koizumi K., Uemura T., Ueda T., Friml J., Nakano A., Fukuda H. sanar@psb.vib-ugent.be Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence sanar@psb.vib-ugent.be Accepted 2015-MAY-07 by ORCHARD Development (Cambridge, England) 2009 imex curation Phosphoinositide-dependent regulation of VAN3 ARF-GAP localization and activity essential for vascular tissue continuity in plants. Phosphoinositide-dependent regulation of VAN3 ARF-GAP localization and activity essential for vascular tissue continuity in plants. Development (Cambridge, England) 2009 imex curation Naramoto S., Sawa S., Koizumi K., Uemura T., Ueda T., Friml J., Nakano A., Fukuda H. sanar@psb.vib-ugent.be Only protein-protein interactions arath-protoplast Arabidopsis thaliana protoplast Protoplast defined as a membrane-bound cell from which the outer wall has been partially or completely removed. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Naramoto S., Sawa S., Koizumi K., Uemura T., Ueda T., Friml J., Nakano A., Fukuda H. sanar@psb.vib-ugent.be Accepted 2015-MAY-07 by ORCHARD Development (Cambridge, England) 2009 imex curation vab_arath VAN3-binding protein VAB FKD1 Protein FORKED 1 F16M2_150 At3g63300 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MERELRRPNPINSSRRPEIFSSGGSSTQLPESPRGPMEFLSRSWSVSALEVSRALHTAKSASATNRPPSSINTPIPEETLNPEKEECPPENSTSVSSQFSFAASATSQLVLERIMSQSEVSPLTSGRLSHSSGPLNGGGSFTETDSPPISPSDEFDDVIKYFRTHNTIHPLFSGTGGSRGTTGNGSNTPMAGTGPKTVGRWLKDRKEKKKEETRTQNAQVHAAVSVAAVASAVAAVAAATAASSPGKNEQMARIDMAMASAAALVAAQCVEAAEIMGADRDHLTSVVSSAVNVKSHDDIVTLTAAAATALRGAATLKARALKEVWNIAAVLPAEKGASSALCGQVDTKHSDSSFSGELPVAGEDFLGVCNQELLAKGTELLKRTRGGELHWKIVSVYINKAGQAVLKMKSKHVGGTFTKKKKHMVLEVRKDIPAWAGRDLFNGDKHHYFGLKTETKRVIEFECRNQREYEIWTQGVSRLLAIAAEKKQKSSMSKWMAP 633026046AB486B3 agd3_arath ADP-ribosylation factor GTPase-activating protein AGD3 SFC Protein SCARFACE AGD3 T31B5.120 At5g13300 VAN3 Protein ARF-GAP DOMAIN 3 Protein VASCULAR NETWORK 3 FKD2 Protein FORKED 2 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MHFTKLDDSPMFRKQLQSMEESAEILRERSLKFYKGCRKYTEGLGEAYDGDIAFASALETFGGGHNDPISVAFGGPVMTKFTIALREIGTYKEVLRSQVEHILNDRLLQFANMDLHEVKEARKRFDKASLTYDQAREKFLSLRKGTKSDVAAALEQELHTSRSMFEQARFNLVTALSNVEAKKRFEFLEAVSGTMDAHLRYFKQGYELLHQMEPYINQVLTYAQQSRERSNYEQAALNEKMQEYKRQVDRESRWGSNGSNGSPNGDGIQAIGRSSHKMIDAVMQSAARGKVQTIRQGYLSKRSSNLRGDWKRRFFVLDSRGMLYYYRKQCSKPSGSGSQLSGQRNSSELGSGLLSRWLSSNNHGHGGVHDEKSVARHTVNLLTSTIKVDADQSDLRFCFRIISPTKNYTLQAESALDQMDWIEKITGVIASLLSSQVPEQRLPGSPMGSGHHRSASESSSYESSEYDHPTTEEFVCERSFLGYNERPSRSFQPQRSIRKGEKPIDALRKVCGNDKCADCGAPEPDWASLNLGVLVCIECSGVHRNLGVHISKVRSLTLDVKVWEPSVISLFQALGNTFANTVWEELLHSRSAIHFDPGLTVSDKSRVMVTGKPSYADMISIKEKYIQAKYAEKLFVRRSRDSDFPQSAAQQMWDAVSGNDKKAVYRLIVNGDADVNYVYDQTSSSSLTLSRVILVPERPKREDVLLRLRNELLDRTGSSSNISPEGSGGSSLLHCACEKADLGMVELLLQYGANVNASDSSGQTPLHCCLLRGKVTIARLLLTRGADPEAMNREGKTALDIAAESNFTDPEVLALLSDTNGYNHRQC 59FF5BAA10584DD7 van3-vab-1 3 6 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey physical association physical association vab-van3-1 1 5 unspecified role unspecified role bait bait 6 unspecified role unspecified role prey prey physical association physical association supplemental Fig.S5 van3-vab-2 1 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association supplemental Fig.S5 van3-vab-3 2 5 unspecified role unspecified role neutral component neutral component region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig.5C-E van3-vab-4 4 5 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig.5F-G