IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Specific heteromeric association of four transmembrane peptides derived from platelet glycoprotein Ib-IX complex. Specific heteromeric association of four transmembrane peptides derived from platelet glycoprotein Ib-IX complex. Journal of molecular biology 2008 imex curation Luo SZ., Li R., Luo SZ., Li R. renhao.li@uth.tmc.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence Luo SZ., Li R., Luo SZ., Li R. Purified TM peptides were mixed with detergents, dried and rehydrated in reaction buffer. The reaction products were analyzed by reverse-phase HPLC and the assignment of the each peak was assisted by mass determination. renhao.li@uth.tmc.edu ude.cmt.htu@il.oahner Accepted 2015-NOV-26 AT 14:42 GMT AT 14:42 GMT by PPORRAS Journal of molecular biology 2008 Only protein-protein interactions imex curation imex curation The author did give stoichiometry "During electrophoresis in SDS, Ibβ-TM could migrate mostly as a dimer or sometimes as higher-order oligomers at higher concentrations (Fig. 3)."; Exp-mod comment expanded.; Stoichiometry removed from this one Specific heteromeric association of four transmembrane peptides derived from platelet glycoprotein Ib-IX complex. Specific heteromeric association of four transmembrane peptides derived from platelet glycoprotein Ib-IX complex. Journal of molecular biology 2008 imex curation Luo SZ., Li R., Luo SZ., Li R. renhao.li@uth.tmc.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro comigration in sds comigration in sds page comigration in sds weight by staining molecular weight estimation by staining weight by staining Luo SZ., Li R., Luo SZ., Li R. renhao.li@uth.tmc.edu ude.cmt.htu@il.oahner Accepted 2015-NOV-26 AT 14:42 GMT AT 14:42 GMT by PPORRAS Journal of molecular biology 2008 Only protein-protein interactions imex curation imex curation The author did give stoichiometry "During electrophoresis in SDS, Ibβ-TM could migrate mostly as a dimer or sometimes as higher-order oligomers at higher concentrations (Fig. 3)."; Exp-mod comment expanded.; Stoichiometry removed from this one Specific heteromeric association of four transmembrane peptides derived from platelet glycoprotein Ib-IX complex. Specific heteromeric association of four transmembrane peptides derived from platelet glycoprotein Ib-IX complex. Journal of molecular biology 2008 imex curation Luo SZ., Li R., Luo SZ., Li R. renhao.li@uth.tmc.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro reverse phase chrom reverse phase chromatography reverse phase chrom ms participant Identification by mass spectrometry ms participant Luo SZ., Li R., Luo SZ., Li R. Purified TM peptides were mixed with detergents, dried and rehydrated in reaction buffer. GP1A-TM and GP1b-TM were mixed together with n-dodecyl beta-D-maltoside at a molar ratio of 1:2:200 which was taken as an indication of complex stoichiometry. The reaction products were analyzed by reverse-phase HPLC and the assignment of the each peak was assisted by mass determination. The molar ratio of GP9 was not given. renhao.li@uth.tmc.edu ude.cmt.htu@il.oahner Accepted 2015-NOV-26 AT 14:42 GMT AT 14:42 GMT by PPORRAS Journal of molecular biology 2008 Only protein-protein interactions imex curation imex curation The author did give stoichiometry "During electrophoresis in SDS, Ibβ-TM could migrate mostly as a dimer or sometimes as higher-order oligomers at higher concentrations (Fig. 3)."; Exp-mod comment expanded.; Stoichiometry removed from this one Specific heteromeric association of four transmembrane peptides derived from platelet glycoprotein Ib-IX complex. Specific heteromeric association of four transmembrane peptides derived from platelet glycoprotein Ib-IX complex. Journal of molecular biology 2008 imex curation Luo SZ., Li R., Luo SZ., Li R. renhao.li@uth.tmc.edu 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions imex curation ecoli Escherichia coli (strain K12) toxcat tox-r dimerization assay toxcat predetermined predetermined participant predetermined Luo SZ., Li R., Luo SZ., Li R. Source of GYPA inferred from mutant mapping. renhao.li@uth.tmc.edu ude.cmt.htu@il.oahner Accepted 2015-NOV-26 AT 14:42 GMT AT 14:42 GMT by PPORRAS Journal of molecular biology 2008 Only protein-protein interactions imex curation imex curation The author did give stoichiometry "During electrophoresis in SDS, Ibβ-TM could migrate mostly as a dimer or sometimes as higher-order oligomers at higher concentrations (Fig. 3)."; Exp-mod comment expanded.; Stoichiometry removed from this one gp1bb_human Platelet glycoprotein Ib beta chain GP1BB Antigen CD42b-beta protein protein human Homo sapiens Human MGSGPRGALSLLLLLLAPPSRPAAGCPAPCSCAGTLVDCGRRGLTWASLPTAFPVDTTELVLTGNNLTALPPGLLDALPALRTAHLGANPWRCDCRLVPLRAWLAGRPERAPYRDLRCVAPPALRGRLLPYLAEDELRAACAPGPLCWGALAAQLALLGLGLLHALLLVLLLCRLRRLRARARARAAARLSLTDPLVAERAGTDES B5E81EB6F57DE0D9 gpix_human Platelet glycoprotein IX GP9 Glycoprotein 9 protein protein human Homo sapiens Human MPAWGALFLLWATAEATKDCPSPCTCRALETMGLWVDCRGHGLTALPALPARTRHLLLANNSLQSVPPGAFDHLPQLQTLDVTQNPWHCDCSLTYLRLWLEDRTPEALLQVRCASPSLAAHGPLGRLTGYQLGSCGWQLQASWVRPGVLWDVALVAVAALGLALLAGLLCATTEALD 6A023B96C7854D59 gp1ba_human Platelet glycoprotein Ib alpha chain GP1BA Antigen CD42b-alpha protein protein human Homo sapiens Human MPLLLLLLLLPSPLHPHPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLYTFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTVLDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNAENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDTEGDKVRATRTVVKFPTKAHTTPWGLFYSWSTASLDSQMPSSLHPTQESTKEQTTFPPRWTPNFTLHMESITFSKTPKSTTEPTPSPTTSEPVPEPAPNMTTLEPTPSPTTPEPTSEPAPSPTTPEPTSEPAPSPTTPEPTSEPAPSPTTPEPTPIPTIATSPTILVSATSLITPKSTFLTTTKPVSLLESTKKTIPELDQPPKLRGVLQGHLESSRNDPFLHPDFCCLLPLGFYVLGLFWLLFASVVLILLLSWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL 053346683AEB927E p02724-pro_0000012134 Glycophorin-A GYPA GPA MN sialoglycoprotein PAS-2 Sialoglycoprotein alpha protein protein human Homo sapiens Human SSTTGVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKKSPSDVKPLPSPDTDVPLSSVEIENPETSDQ 20 150 D61E2A7A4A91552B gp1bb-1 4 5 unspecified role unspecified role neutral component neutral component transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range n-terminal toxr tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 2B gypa-1 4 8 unspecified role unspecified role neutral component neutral component transmembrane region sufficient to bind sufficient binding region sufficient to bind range range range range n-terminal toxr tag tag tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range c-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P02724-PRO_0000012134:p.Gly83Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain G A Wed May 02 17:00:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly83ala' Tue Jun 30 17:54:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly83Ala' physical association physical association Fig. 2B gp1bb-2 2 5 unspecified role unspecified role neutral component neutral component P13224:p.Cys141_Pro145delinsGlySerGlyGlyGly mutation mutation certain certain sequence position certain certain certain sequence position certain CAPGP GSGGG Wed May 02 19:53:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys_ala_pro_gly_pro141-145gly_ser_gly_gly_gly' Tue Jun 30 16:06:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys141_Pro145delinsGlySerGlyGlyGly' P13224:p.Cys173Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 14:51:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys173ser' Tue Jun 30 18:17:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys173Ser' transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Fig. 3 gp1ba-gp1bb-5 3 5 unspecified role unspecified role neutral component neutral component P13224:p.Cys141_Pro145delinsGlySerGlyGlyGly mutation mutation certain certain sequence position certain certain certain sequence position certain CAPGP GSGGG Wed May 02 19:00:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys_ala_pro_gly_pro141-145gly_ser_gly_gly_gly' Tue Jun 30 20:17:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys141_Pro145delinsGlySerGlyGlyGly' P13224:p.Cys173Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 18:21:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys173ser' Tue Jun 30 17:09:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys173Ser' transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P07359:p.Glu513Gly mutation mutation certain certain sequence position certain certain certain sequence position certain E G Wed May 02 19:59:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu513gly' Tue Jun 30 19:31:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu513Gly' chemical synthesis Chemical synthesis (Chemical synthesis) 31 29 direct interaction direct interaction Fig. 4 Two disulphide bridges form between the alpha and beta peptides gp1ba-gp1bb-2 3 6 unspecified role unspecified role neutral component neutral component transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P14770:p.Ser142_Trp143delinsGlySer mutation mutation certain certain sequence position certain certain certain sequence position certain SW GS Fri Jul 22 10:51:07 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'region' Wed May 02 17:45:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_trp142-143gly_ser' Tue Jun 30 19:48:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser142_Trp143delinsGlySer' P14770:p.Cys170Asn mutation mutation certain certain sequence position certain certain certain sequence position certain C N Wed May 02 15:46:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys170asn' Tue Jun 30 19:04:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys170Asn' chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component P13224:p.Cys141_Pro145delinsGlySerGlyGlyGly mutation mutation certain certain sequence position certain certain certain sequence position certain CAPGP GSGGG Wed May 02 15:45:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys_ala_pro_gly_pro141-145gly_ser_gly_gly_gly' Tue Jun 30 19:01:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys141_Pro145delinsGlySerGlyGlyGly' P13224:p.Cys173Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:00:10 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys173ser' Tue Jun 30 19:05:27 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys173Ser' transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role neutral component neutral component transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P07359:p.Glu513Gly mutation mutation certain certain sequence position certain certain certain sequence position certain E G Wed May 02 20:09:55 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu513gly' Tue Jun 30 16:47:07 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu513Gly' chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 4 Two disulphide bridges form between the alpha and beta peptides. Addition of IX-TM significantly facilitated formation of native-like disulfide bonds between alpha and beta peptides in detergent micelles gp1ba-gp1bb-3 1 6 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept cys-170 cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P14770:p.Ser142_Trp143delinsGlySer mutation mutation certain certain sequence position certain certain certain sequence position certain SW GS Wed May 02 20:18:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_trp142-143gly_ser' Tue Jun 30 18:14:44 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser142_Trp143delinsGlySer' P14770:p.Cys170Asn mutation mutation certain certain sequence position certain certain certain sequence position certain C N Wed May 02 18:09:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys170asn' Tue Jun 30 18:34:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys170Asn' chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component P13224:p.Cys141_Pro145delinsGlySerGlyGlyGly mutation mutation certain certain sequence position certain certain certain sequence position certain CAPGP GSGGG Wed May 02 18:12:04 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys_ala_pro_gly_pro141-145gly_ser_gly_gly_gly' Tue Jun 30 17:14:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys141_Pro145delinsGlySerGlyGlyGly' P13224:p.Cys173Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 17:59:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys173ser' Tue Jun 30 19:33:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys173Ser' transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role fluorescence donor fluorescence donor n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal cy3 label cy3 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P07359:p.Glu513Gly mutation mutation certain certain sequence position certain certain certain sequence position certain E G Wed May 02 16:56:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu513gly' Tue Jun 30 16:07:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu513Gly' chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 8B, 8C Two disulphide bridges form between the alpha and beta peptides. Addition of IX-TM significantly facilitated formation of native-like disulfide bonds between alpha and beta peptides in detergent micelles gp1ba-gp1bb-4 1 6 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept cys-170 cy5 label cy5 label certain certain sequence position certain certain certain sequence position certain transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P14770:p.Ser142_Trp143delinsGlySer mutation mutation certain certain sequence position certain certain certain sequence position certain SW GS Fri Jul 22 10:53:10 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'region' Wed May 02 19:27:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_trp142-143gly_ser' Tue Jun 30 16:14:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser142_Trp143delinsGlySer' P14770:p.Cys170Asn mutation mutation certain certain sequence position certain certain certain sequence position certain C N Wed May 02 15:35:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys170asn' Tue Jun 30 16:07:49 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys170Asn' chemical synthesis Chemical synthesis (Chemical synthesis) 6 competitor competitor competitor neutral component neutral component transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P14770:p.Ser142_Trp143delinsGlySer mutation mutation certain certain sequence position certain certain certain sequence position certain SW GS Fri Jul 22 10:59:53 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'region' Wed May 02 16:54:00 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser_trp142-143gly_ser' Tue Jun 30 18:16:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser142_Trp143delinsGlySer' P14770:p.Cys170Asn mutation mutation certain certain sequence position certain certain certain sequence position certain C N Wed May 02 17:47:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys170asn' Tue Jun 30 20:14:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys170Asn' chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role neutral component neutral component P13224:p.Cys141_Pro145delinsGlySerGlyGlyGly mutation mutation certain certain sequence position certain certain certain sequence position certain CAPGP GSGGG Wed May 02 16:44:39 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys_ala_pro_gly_pro141-145gly_ser_gly_gly_gly' Tue Jun 30 16:20:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys141_Pro145delinsGlySerGlyGlyGly' P13224:p.Cys173Ser mutation mutation certain certain sequence position certain certain certain sequence position certain C S Wed May 02 20:21:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys173ser' Tue Jun 30 18:41:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Cys173Ser' transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 7 unspecified role unspecified role fluorescence donor fluorescence donor n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal cy3 label cy3 label n-term range n-terminal range n-term range n-term range n-terminal range n-term range transmembrane region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P07359:p.Glu513Gly mutation mutation certain certain sequence position certain certain certain sequence position certain E G Wed May 02 18:07:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu513gly' Tue Jun 30 18:30:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu513Gly' chemical synthesis Chemical synthesis (Chemical synthesis) physical association physical association Fig. 8B Two disulphide bridges form between the alpha and beta peptides. Addition of IX-TM significantly facilitated formation of native-like disulfide bonds between alpha and beta peptides in detergent micelles