IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The Hsp40 chaperone Jjj1 is required for the nucleo-cytoplasmic recycling of preribosomal factors in Saccharomyces cerevisiae. The Hsp40 chaperone Jjj1 is required for the nucleo-cytoplasmic recycling of preribosomal factors in Saccharomyces cerevisiae. RNA (New York, N.Y.) 2007 imex curation Demoinet E., Jacquier A., Lutfalla G., Fromont-Racine M. lutfalla@univ-montp2.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast tap tandem affinity purification TAP TAP tap polyclonal western polyclonal antibody western blot polyclonal western Demoinet E., Jacquier A., Lutfalla G., Fromont-Racine M. lutfalla@univ-montp2.fr Accepted 2015-AUG-17 by ORCHARD RNA (New York, N.Y.) 2007 imex curation The Hsp40 chaperone Jjj1 is required for the nucleo-cytoplasmic recycling of preribosomal factors in Saccharomyces cerevisiae. The Hsp40 chaperone Jjj1 is required for the nucleo-cytoplasmic recycling of preribosomal factors in Saccharomyces cerevisiae. RNA (New York, N.Y.) 2007 imex curation Demoinet E., Jacquier A., Lutfalla G., Fromont-Racine M. lutfalla@univ-montp2.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast cosedimentation cosedimentation western blot western blot Immuno blot Immuno blot Demoinet E., Jacquier A., Lutfalla G., Fromont-Racine M. lutfalla@univ-montp2.fr Accepted 2015-AUG-17 by ORCHARD RNA (New York, N.Y.) 2007 imex curation The Hsp40 chaperone Jjj1 is required for the nucleo-cytoplasmic recycling of preribosomal factors in Saccharomyces cerevisiae. The Hsp40 chaperone Jjj1 is required for the nucleo-cytoplasmic recycling of preribosomal factors in Saccharomyces cerevisiae. RNA (New York, N.Y.) 2007 imex curation Demoinet E., Jacquier A., Lutfalla G., Fromont-Racine M. lutfalla@univ-montp2.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast two hybrid array two hybrid array predetermined predetermined participant predetermined Demoinet E., Jacquier A., Lutfalla G., Fromont-Racine M. lutfalla@univ-montp2.fr Accepted 2015-AUG-17 by ORCHARD RNA (New York, N.Y.) 2007 imex curation The Hsp40 chaperone Jjj1 is required for the nucleo-cytoplasmic recycling of preribosomal factors in Saccharomyces cerevisiae. The Hsp40 chaperone Jjj1 is required for the nucleo-cytoplasmic recycling of preribosomal factors in Saccharomyces cerevisiae. RNA (New York, N.Y.) 2007 imex curation Demoinet E., Jacquier A., Lutfalla G., Fromont-Racine M. lutfalla@univ-montp2.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast tap tandem affinity purification TAP TAP tap anti tag western anti tag western blot anti tag western Demoinet E., Jacquier A., Lutfalla G., Fromont-Racine M. lutfalla@univ-montp2.fr Accepted 2015-AUG-17 by ORCHARD RNA (New York, N.Y.) 2007 imex curation The Hsp40 chaperone Jjj1 is required for the nucleo-cytoplasmic recycling of preribosomal factors in Saccharomyces cerevisiae. The Hsp40 chaperone Jjj1 is required for the nucleo-cytoplasmic recycling of preribosomal factors in Saccharomyces cerevisiae. RNA (New York, N.Y.) 2007 imex curation Demoinet E., Jacquier A., Lutfalla G., Fromont-Racine M. lutfalla@univ-montp2.fr 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Demoinet E., Jacquier A., Lutfalla G., Fromont-Racine M. lutfalla@univ-montp2.fr Accepted 2015-AUG-17 by ORCHARD RNA (New York, N.Y.) 2007 imex curation mak11_yeast Protein MAK11 MAK11 Maintenance of killer protein 11 YKL021C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAIGDKNQFRIIVGSYEHNILCLSLDIPNQKENDAAKTPHFMPIFHFQAHSLSIKCLAVSRRYLVSGSNDEHIRIYDLQKRKELGTLLSHQGSITALQFSHPASSSEDAAVSKGSKNSKWLLSASEDHKIMVWRVKDWETVGTLKGHTARVNDVDIHPTNRIAISVSDDHSIRLWNLMTLRNAAVLKLRKYNTNGTCVRWLGAKGDYFAVGLRDRVLIYETGSAKVFKEIVFQRKTLMHIETHILPFDNKEYLSVGISDGNVHFYPCEELFEKVEENEKQEDDDDKEDISPAFSLLGHTNRIKDFKFYTNEFGTYLVTIGSDGKIVVWDMSTKEQVAVYDCGERLNCLTLCDESIEKYNTMKKRDAETADIGDQSEVESDTEELKKIMFGEKKKLNKKKRKQLKKSKVSVELE B3BD72C4E37ACF11 B3BD72C4E37ACF11 rei1_yeast Cytoplasmic 60S subunit biogenesis factor REI1 REI1 Required for isotropic bud growth protein 1 pre-60S factor REI1 YBR1736 YBR267W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSSGVYTCNSCVLTFDSSDEQRAHMKSDWHRYNLKRRVAQLPPISFETFDSKVSAAAASTSKSAEKEKPVTKKELKRREKQALLEKKKKLLEIARANMLENMQKSQEGNTPDLSKLSLQENEENKEKEEPKKEEPEQLTEEEMAERVMQEKLRNRVDIPLEQCLFCEHNKHFKDVEENLEHMFRTHGFYIPEQKYLVDKIGLVKYMSEKIGLGNICIVCNYQGRTLTAVRQHMLAKRHCKIPYESEDERLEISEFYDFTSSYANFNSNTTPDNEDDWEDVGSDEAGSDDEDLPQEYLYNDGIELHLPTGIKVGHRSLQRYYKQDLKPEVILTEGQGTLVAAETRSFLPAFDKKGVQTQQRVWQTERFDKKRLDKRSAKFVNNQPHYRDQLLQ D01AA8FFDF4A0BAC D01AA8FFDF4A0BAC alb1_yeast Ribosome biogenesis protein ALB1 J0723 YJL122W ALB1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPSKNSINRPKLTSNLHHKVHSLNKKRAQRERAGLLKPARSSVNSKSGEIKSVALDLYFQNKKNESQNSTAVTLQNASSSPASITTRTLSKKRAKKIERNLKYATQRKLLVDASAKLEDEMDIDLDGGKKVKENEKKSSLTLVKEALWSVIDDTASQGLIIENGQGTTLGGPFFP 3DECC43269EBB6D3 3DECC43269EBB6D3 jjj1_yeast J protein JJJ1 JJJ1 N1254 YNL227C protein protein yeast Saccharomyces cerevisiae Baker's yeast MKTCYYELLGVETHASDLELKKAYRKKALQYHPDKNPDNVEEATQKFAVIRAAYEVLSDPQERAWYDSHKEQILNDTPPSTDDYYDYEVDATVTGVTTDELLLFFNSALYTKIDNSAAGIYQIAGKIFAKLAKDEILSGKRLGKFSEYQDDVFEQDINSIGYLKACDNFINKTDKLLYPLFGYSPTDYEYLKHFYKTWSAFNTLKSFSWKDEYMYSKNYDRRTKREVNRRNEKARQQARNEYNKTVKRFVVFIKKLDKRMKEGAKIAEEQRKLKEQQRKNELNNRRKFGNDNNDEEKFHLQSWQTVKEENWDELEKVYDNFGEFENSKNDKEGEVLIYECFICNKTFKSEKQLKNHINTKLHKKNMEEIRKEMEEENITLGLDNLSDLEKFDSADESVKEKEDIDLQALQAELAEIERKLAESSSEDESEDDNLNIEMDIEVEDVSSDENVHVNTKNKKKRKKKKKAKVDTETEESESFDDTKDKRSNELDDLLASLGDKGLQTDDDEDWSTKAKKKKGKQPKKNSKSTKSTPSLSTLPSSMSPTSAIEVCTTCGESFDSRNKLFNHVKIAGHAAVKNVVKRKKVKTKRI 0D184EF861105C95 0D184EF861105C95 rlp24_yeast Ribosome biogenesis protein RLP24 RLP24 Ribosomal protein L24-like YLR009W protein protein yeast Saccharomyces cerevisiae Baker's yeast MRIYQCHFCSSPCYPGHGIMFVRNDAKEFRFCRSKCHKAFKQRRNPRKLKWTKAFRKAAGKELAVDSTLTFAQRRNVPVRYNRELVATTLKAMARIEEIRQKRERAFYKNRMRGNKEKDFLRDKKLVESNPELLRIREVEIARKLAKEQERAESVSEQEESEEEEEDMEIDSDEEEEEQLEKQKILLKNRRRNTKKIAF D7F1CD7EB92C6576 D7F1CD7EB92C6576 arx1_yeast Probable metalloprotease ARX1 Associated with ribosomal export complex protein 1 ARX1 YD8557.10c YDR101C protein protein yeast Saccharomyces cerevisiae Baker's yeast MALAISHEDTQILLKDKNILQESVLNKYRTAGQIAQTALKYVTSLINDSYHSKTTQRQLTVPELCLLTDSFILTRLEQYYKNKVNERGIAIPTTIDIDQISGGWCPEIDDTQNLLNWNKGKDSTFASSVTGTLRPGDLVKITLGVHIDGYTSEVSHTMVIYPVDETKPILQPTGPLLGGKADAVAAAHIAMETVVALLACALTPEKLPASLGGTSSGITGQLIRTIVDTIARSYNCGVVPGSRVRRIRRFLAGQNEGIVAEREYKGVVWTESHQEADLLSNTDAKDLTVVDRGQSTPFTNVSAIPSDDFVVQSGEVYLIDLKMASLEHCTKKGLVTLETVDSYTGKSHKAGELIARPGAYVRDFAQTHILKLKTSRQLLTKIDKQGVYPFKLSHLSSNFPFVHENEEELQSLKKDLKSFRLGMSEISNNYLCVESPIQIARWVPWDHILKATNPNGNLSYDATSTLTLPGHELPLPKLGVSAIKLKSLMNSTKESISLPVARECNTIVLCDSSVSTTDRPELLRLTGGSKTCQPSWIHSQHELNPQDSIVQGIFQLATLAKDKRFGLLLKETQPMKQKSVETSNGGVEETMKM E68A7896FAFA6A0C E68A7896FAFA6A0C if6_yeast Eukaryotic translation initiation factor 6 TIF6 CDC95 YPR016C LPZ15C protein protein yeast Saccharomyces cerevisiae Baker's yeast MATRTQFENSNEIGVFSKLTNTYCLVAVGGSENFYSAFEAELGDAIPIVHTTIAGTRIIGRMTAGNRRGLLVPTQTTDQELQHLRNSLPDSVKIQRVEERLSALGNVICCNDYVALVHPDIDRETEELISDVLGVEVFRQTISGNILVGSYCSLSNQGGLVHPQTSVQDQEELSSLLQVPLVAGTVNRGSSVVGAGMVVNDYLAVTGLDTTAPELSVIESIFRLQDAQPESISGNLRDTLIETYS 1BCE041C61DFD2A8 1BCE041C61DFD2A8 rl1a_yeast 60S ribosomal protein L1-A RPL1A L10a SSM1 SSM1A YPL220W Large ribosomal subunit protein uL1-A protein protein yeast Saccharomyces cerevisiae Baker's yeast MSKITSSQVREHVKELLKYSNETKKRNFLETVELQVGLKNYDPQRDKRFSGSLKLPNCPRPNMSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIKQVPRLLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQLKKVLCLAVAVGNVEMEEDVLVNQILMSVNFFVSLLKKNWQNVGSLVVKSSMGPAFRLY mint C890A90505655F2A jjj1_rei1-1 3 9 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig1A rei1-jjj1-1 3 9 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig1A rei1-rlp24-1 3 10 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait physical association physical association Fig1A rlp24-rei1-1 3 10 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Fig1A arx1_alb1-1 3 8 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Fig1A arx1-alb1-3 3 11 unspecified role unspecified role prey prey 11 unspecified role unspecified role bait bait physical association physical association Fig1A rei1-jjj1-3 4 9 unspecified role unspecified role prey prey Myc myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 7 unspecified role unspecified role bait bait TAP tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig2 B jjj1-rei1-1 4 9 unspecified role unspecified role bait bait Tap tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 7 unspecified role unspecified role prey prey Myc myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig2 B rpl24_rpl1-1 1 13 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait Tap tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig2B mak11-rpl1a-1 1 13 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait Tap tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged c-term range C-terminal range c-term range c-term range C-terminal range c-term range 10 unspecified role unspecified role prey prey association association Fig2B arx1_alb1-4 2 12 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component GFP gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig5 rei1-jjj1-4 5 9 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait physical association physical association Fig1A