IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Calcyon, a novel partner of clathrin light chain, stimulates clathrin-mediated endocytosis. Calcyon, a novel partner of clathrin light chain, stimulates clathrin-mediated endocytosis. The Journal of biological chemistry 2006 imex curation Xiao J., Dai R., Negyessy L., Bergson C. I've not included the transferrin data (Fig. 4) as I think its only being included as a marker. cbergson@mail.mcg.edu 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Xiao J., Dai R., Negyessy L., Bergson C. I've not included the transferrin data (Fig. 4) as I think its only being included as a marker. cbergson@mail.mcg.edu Accepted 2016-FEB-11 AT 15:39 GMT AT 15:39 GMT by PPORRAS The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation Calcyon, a novel partner of clathrin light chain, stimulates clathrin-mediated endocytosis. Calcyon, a novel partner of clathrin light chain, stimulates clathrin-mediated endocytosis. The Journal of biological chemistry 2006 imex curation Xiao J., Dai R., Negyessy L., Bergson C. I've not included the transferrin data (Fig. 4) as I think its only being included as a marker. cbergson@mail.mcg.edu 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Xiao J., Dai R., Negyessy L., Bergson C. I've not included the transferrin data (Fig. 4) as I think its only being included as a marker. cbergson@mail.mcg.edu Accepted 2016-FEB-11 AT 15:39 GMT AT 15:39 GMT by PPORRAS Human brain cDNA The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation Calcyon, a novel partner of clathrin light chain, stimulates clathrin-mediated endocytosis. Calcyon, a novel partner of clathrin light chain, stimulates clathrin-mediated endocytosis. The Journal of biological chemistry 2006 imex curation Xiao J., Dai R., Negyessy L., Bergson C. I've not included the transferrin data (Fig. 4) as I think its only being included as a marker. cbergson@mail.mcg.edu 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation mouse-neocortex Mus musculus Neocortex neocortex NEOCORTEX The neocortex is the top layer of the cerebral hemispheres, 2-4 mm thick, and made up of six layers, labelled I to VI (with VI being the innermost and I being the outermost). It is involved in higher functions such as sensory perception, generation of motor commands, spatial reasoning, conscious thought, and in humans, language. confocal microscopy confocal microscopy immunostaining immunostaining Xiao J., Dai R., Negyessy L., Bergson C. I've not included the transferrin data (Fig. 4) as I think its only being included as a marker. cbergson@mail.mcg.edu Accepted 2016-FEB-11 AT 15:39 GMT AT 15:39 GMT by PPORRAS Human brain cDNA The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation Calcyon, a novel partner of clathrin light chain, stimulates clathrin-mediated endocytosis. Calcyon, a novel partner of clathrin light chain, stimulates clathrin-mediated endocytosis. The Journal of biological chemistry 2006 imex curation Xiao J., Dai R., Negyessy L., Bergson C. I've not included the transferrin data (Fig. 4) as I think its only being included as a marker. cbergson@mail.mcg.edu 22-Feb-2016: Contacted by IntAct-Help. Only protein-protein interactions imex curation yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Xiao J., Dai R., Negyessy L., Bergson C. I've not included the transferrin data (Fig. 4) as I think its only being included as a marker. cbergson@mail.mcg.edu Accepted 2016-FEB-11 AT 15:39 GMT AT 15:39 GMT by PPORRAS Human brain cDNA The Journal of biological chemistry 2006 Only protein-protein interactions imex curation imex curation ap1g1_human AP-1 complex subunit gamma-1 Adaptor protein complex AP-1 subunit gamma-1 Golgi adaptor HA1/AP1 adaptin subunit gamma-1 Gamma1-adaptin Clathrin assembly protein complex 1 gamma-1 large chain AP1G1 ADTG CLAPG1 Adaptor-related protein complex 1 subunit gamma-1 protein protein human Homo sapiens Human MPAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNVAKLLYMHMLGYPAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQDVHLLMTNCIKNDLNHSTQFVQGLALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATKNLLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGISDPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATNTETSKNVGNAILYETVLTIMDIKSESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQTDHNAVQRHRSTIVDCLKDLDVSIKRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFKADCASGIFLAAEKYAPSKRWHIDTIMRVLTTAGSYVRDDAVPNLIQLITNSVEMHAYTVQRLYKAILGDYSQQPLVQVAAWCIGEYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNMSTSVTRGYALTAIMKLSTRFTCTVNRIKKVVSIYGSSIDVELQQRAVEYNALFKKYDHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTSQANDLLDLLGGNDITPVIPTAPTSKPSSAGGELLDLLGDINLTGAPAAAPAPASVPQISQPPFLLDGLSSQPLFNDIAAGIPSITAYSKNGLKIEFTFERSNTNPSVTVITIQASNSTELDMTDFVFQAAVPKTFQLQLLSPSSSIVPAFNTGTITQVIKVLNPQKQQLRMRIKLTYNHKGSAMQDLAEVNNFPPQSWQ 42EF40223DFBA5E9 caly_human Neuron-specific vesicular protein calcyon CALY DRD1IP protein protein human Homo sapiens Human MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ 7B3ACA9042819F58 ap3d1_human AP-3 complex subunit delta-1 AP-3 complex subunit delta Delta-adaptin AP3D1 PRO0039 Adaptor-related protein complex 3 subunit delta-1 protein protein human Homo sapiens Human MALKMVKGSIDRMFDKNLQDLVRGIRNHKEDEAKYISQCIDEIKQELKQDNIAVKANAVCKLTYLQMLGYDISWAAFNIIEVMSASKFTFKRIGYLAASQSFHEGTDVIMLTTNQIRKDLSSPSQYDTGVALTGLSCFVTPDLARDLANDIMTLMSHTKPYIRKKAVLIMYKVFLKYPESLRPAFPRLKEKLEDPDPGVQSAAVNVICELARRNPKNYLSLAPLFFKLMTSSTNNWVLIKIIKLFGALTPLEPRLGKKLIEPLTNLIHSTSAMSLLYECVNTVIAVLISLSSGMPNHSASIQLCVQKLRILIEDSDQNLKYLGLLAMSKILKTHPKSVQSHKDLILQCLDDKDESIRLRALDLLYGMVSKKNLMEIVKKLMTHVDKAEGTTYRDELLTKIIDICSQSNYQYITNFEWYISILVELTRLEGTRHGHLIAAQMLDVAIRVKAIRKFAVSQMSALLDSAHLLASSTQRNGICEVLYAAAWICGEFSEHLQEPHHTLEAMLRPRVTTLPGHIQAVYVQNVVKLYASILQQKEQAGEAEGAQAVTQLMVDRLPQFVQSADLEVQERASCILQLVKHIQKLQAKDVPVAEEVSALFAGELNPVAPKAQKKVPVPEGLDLDAWINEPLSDSESEDERPRAVFHEEEQRRPKHRPSEADEEELARRREARKQEQANNPFYIKSSPSPQKRYQDTPGVEHIPVVQIDLSVPLKVPGLPMSDQYVKLEEERRHRQKLEKDKRRKKRKEKEKKGKRRHSSLPTESDEDIAPAQQVDIVTEEMPENALPSDEDDKDPNDPYRALDIDLDKPLADSEKLPIQKHRNTETSKSPEKDVPMVEKKSKKPKKKEKKHKEKERDKEKKKEKEKKKSPKPKKKKHRKEKEERTKGKKKSKKQPPGSEEAAGEPVQNGAPEEEQLPPESSYSLLAENSYVKMTCDIRGSLQEDSQVTVAIVLENRSSSILKGMELSVLDSLNARMARPQGSSVHDGVPVPFQLPPGVSNEAQYVFTIQSIVMAQKLKGTLSFIAKNDEGATHEKLDFRLHFSCSSYLITTPCYSDAFAKLLESGDLSMSSIKVDGIRMSFQNLLAKICFHHHFSVVERVDSCASMYSRSIQGHHVCLLVKKGENSVSVDGKCSDSTLLSNLLEEMKATLAKC DIP protein O14617 original sequence version: 119 1B491DD64EAD5096 clca_human Clathrin light chain A CLTA protein protein human Homo sapiens Human MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH 8D8A3B49E6353D93 caly-clta-1 4 6 unspecified role unspecified role bait bait cytoplasmic domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role prey prey physical association physical association no figure clta-caly-1 1 6 unspecified role unspecified role prey prey purified purified region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region s tag s tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait n-terminal gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 19 15 direct interaction direct interaction Fig. 1 clta-caly-2 3 6 unspecified role unspecified role neutral component neutral component purified purified n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component n-terminal egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Fig. 3A-C caly-clta-2 2 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait purified purified n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 8 tag fluorescence tag visualisation by fluorescence tag fluorescence western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Fig. 3E Alpha-adaptin was also identified in this complex but could not be ascribed to a single gene product.