IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Saccharomyces SRP RNA secondary structures: a conserved S-domain and extended Alu-domain. Saccharomyces SRP RNA secondary structures: a conserved S-domain and extended Alu-domain. RNA (New York, N.Y.) 2004 imex curation Van Nues RW., Brown JD. Jeremy.Brown@ncl.ac.uk 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast cosedimentation cosedimentation western blot western blot Immuno blot Immuno blot Van Nues RW., Brown JD. Jeremy.Brown@ncl.ac.uk Accepted 2015-NOV-26 AT 07:58 GMT AT 07:58 GMT by ORCHARD RNA (New York, N.Y.) 2004 imex curation Saccharomyces SRP RNA secondary structures: a conserved S-domain and extended Alu-domain. Saccharomyces SRP RNA secondary structures: a conserved S-domain and extended Alu-domain. RNA (New York, N.Y.) 2004 imex curation Van Nues RW., Brown JD. Jeremy.Brown@ncl.ac.uk 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom primer extension assay primer extension assay primer extension assay Van Nues RW., Brown JD. Jeremy.Brown@ncl.ac.uk Accepted 2015-NOV-26 AT 07:58 GMT AT 07:58 GMT by ORCHARD RNA (New York, N.Y.) 2004 imex curation Saccharomyces SRP RNA secondary structures: a conserved S-domain and extended Alu-domain. Saccharomyces SRP RNA secondary structures: a conserved S-domain and extended Alu-domain. RNA (New York, N.Y.) 2004 imex curation Van Nues RW., Brown JD. Jeremy.Brown@ncl.ac.uk 03-Dec-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast affinity chrom affinity chromatography technology Affinity purification Affinity purification affinity chrom weight by staining molecular weight estimation by staining weight by staining Van Nues RW., Brown JD. Authors stated in PMID:10921896 that the identity of the proteins was confirmed by western blot. Jeremy.Brown@ncl.ac.uk Accepted 2015-NOV-26 AT 07:58 GMT AT 07:58 GMT by ORCHARD RNA (New York, N.Y.) 2004 imex curation srp14_yeast Signal recognition particle subunit SRP14 SRP14 YDL092W D2404 Signal recognition particle 14 kDa protein homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MANTGCLSPGAFLSKVPEFFQTANEKHITVRLTAKRLIEHDPVEGNLEFDSTNHPDYDVSKKASEISVSSRSDREYPLLIRMSYGSHDKKTKCSTVVKASELDQFWQEYSSVFKGGMQNLIKKKKKKSKNGTISKTGKKNKVAKKN 4AF76A26018367EF srp21_yeast Signal recognition particle subunit SRP21 SRP21 YKL122C YKL527 Signal recognition particle 21 kDa protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVKPIDNYITNSVRLFEVNPSQTLFSISYKPPTQKTDTKVSFRTHNSHLSLNYKFTTNKSKDVSRLLSALGPRGVSITPGKIEKIAQSKKKNNKIKESSKKIKGKSIQDIVGLATLIVNTDVEKSDPAAKKTATEPKQKANAVQNNNGNSAASKKKKNKNKGKKKR 19C85378074C6F46 srp68_yeast Signal recognition particle subunit SRP68 YPL243W SRP68 Signal recognition particle 68 kDa protein homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MVAYSPIIATYGNRAEQFLETDSDFAKYHAKLNKKLQHLRSRCHLVTKDTKKYSSKNKYGEINSEDYDNKTKLIGVLILLHAERDLALAETLKLRARQRGKLKKSEEKVLSTRLKKACKTADKLVNVTQNEQQWITRAQYLAFAKLVHSEYLINGKRFKRKDNAKISNNLALVFAALEHLKNLSLLAEEVVDNIVNKYQYSLKQYAGNLITTPEINNFIVERVQSDENKDDELVKLLLDNGFNMKKITTSTEDQKVTTNINWRSFNAKIIDAEVAQFLEQGLSIHPTQITQYTQRLSKLEKALDRHEFFIANHDDQDDIDEMVENSSENNQIILAYIKYNILLTSISRERDLFTHLWNQWLKLNTSLPSKLTKYKEMERIVKNLTKYLSDIMELPGVYSDDELLSQLDLCKLYFQLFLNTGCLSVLYQSKGRYMEALALYVDAYRRLENKLSEIESLDEILLPANLLSLNSVRSLQKRIENGGNSVITLAEYEKRNHGGSLGKYDLTVIEKLDSKKILPTDIQLKNLFPLKPKMLPIPSKPTLFDLAFNYITYDKQEPSASQVKDSVTETESISQTPISNEQTEGEPKKKRGFLGLFGR 241749187CE95499 srp72_yeast Signal recognition particle subunit SRP72 YPL210C SRP72 Signal recognition particle 72 kDa protein homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MAKDNLTNLLSQLNIQLSQDEHSQVEQTCVKLLDSGCENPADVFRRCLVAVIQQDKYQKALHYLKKFKHIDDKYGRKFALEKLYIFYKLNMPDEFNTLYTAIITDDLDTVLKKDIESLRGILHVRAQYCYKNGLYQEAFKIYQHLASHNEKDQDSQIELSCNERVPLSVATELMNRSPLVTPMDESSYDLLFNESFIMASVGKYDKAIELLEKALQGATNEGYQNDINTIKLQLSFVLQMVGKTAQSKEILKGLLQELKADSPFSLICQNNLNAFVDFSKYNTNFNLLLRELNVEKLNTFNLQTFTHEQWSNIQRNVLFLRLFNNVKIHSQESLLSRTFDKYSKLVDNVTLESYKTQAKKLYHHTTKTILSGTDGSTIGILLLTIQLLIIEKEWENAIRIGELFLNESWKSSFEKFNDSQAIVCYILFELYKIKGRNNSKSVLLKKLGSVRVQLSGKIQENIPFWKHVGFELLSMGNAKESKALLREISNFSKGDADVLVDRVVSSDSLDIAQGIDLVRDIDIDKLIQLGVKPLESSAKRSKNTAVSKVQKRKVLELKKKRKIKRLEKFLQGRDTSKLPDPERWLPLRDRSTYRPKKKQQGAKQTQGGAMNKKSEQALDISKKGKPTVNKKPKNKKKGRK DB2F536212F0871B srp54_yeast Signal recognition particle subunit SRP54 SRH1 P9513.14 YPR088C SRP54 Signal recognition particle 54 kDa protein homolog protein protein yeast Saccharomyces cerevisiae Baker's yeast MVLADLGKRINSAVNNAISNTQDDFTTSVDVMLKGIVTALLESDVNIALVSKLRNNIRSQLLSENRSEKSTTNAQTKKLIQKTVFDELCKLVTCEGSEEKAFVPKKRKTNIIMFVGLQGSGKTTSCTKLAVYYSKRGFKVGLVCADTFRAGAFDQLKQNAIRARIPFYGSYTETDPAKVAEEGINKFKKEKFDIIIVDTSGRHHQEEELFQEMIEISNVIKPNQTIMVLDASIGQAAEQQSKAFKESSDFGAIILTKMDGHARGGGAISAVAATNTPIIFIGTGEHIHDLEKFSPKSFISKLLGIGDIESLFEQLQTVSNKEDAKATMENIQKGKFTLLDFKKQMQTIMKMGPLSNIAQMIPGMSNMMNQVGEEETSQKMKKMVYVLDSMTKEELESDGRMFIEEPTRMVRVAKGSGTSVFEVEMILMQQQMMARMAQTATQQQPGAPGANARMPGMPNMPGMPNMPGMPNMPGMPKVTPQMMQQAQQKLKQNPGLMQNMMNMFGGGMGGGMGGGMPDMNEMMKMMQDPQMQQMAKQFGMG 05B1B2C262932F17 05B1B2C262932F17 scr1 yeast Signal Recognition Particle RNA yeast srprna signal recognition particle rna srpRNA srprna yeast Saccharomyces cerevisiae Baker's yeast AGGCUGUAAUGGCUUUCUGGUGGGAUGGGAUACGUUGAGAAUUCUGGCCGAGGAACAAAUCCUUCCUCGCGGCUAGACACGGAUUGCACGCCCUUUGGGCAAGGGAUAGUUCUCUAUUCCGCACCGUGCCCUGUUGUGGCAACCGUCUUUCCUCCGUCGUAAAUUUGUCCUGGGCAGAGCUGUCUGCCCGGAGGCGGGAGAGUCCGUUCUGAAGUGUCCCGGCUAUAAUAAAUCGAUCUUUGCGGGCAGCCCGUUGGCAGGAGGCGUGAGGAAUCCGUCUCUCUGUCUGGUGCGGCAAGGUAGUUCUGGGUCCUUAGGGGCUCCACCUUCACCGCUGUUAGGGGAGUUUUAUCCAGCGUCAGCAAAGGUGACCCGUGAUGGAGGCGGCCGGGAUAGCACAUAUCAGUCGGAUAAUUGUGCAAGUUGAUCGCUUCGGCGGUUUAAUUUGGCGGUGCCAUCAGGAUUUACUCGCACAUUGUGGCCGUUCCCUCGGGGAUGGAGUGUGUCCUGAACCAUAUUUUU sec65_yeast Signal recognition particle subunit SEC65 YM8339.14C YML105C SEC65 protein protein yeast Saccharomyces cerevisiae Baker's yeast MPRLEEIDDFNDIDDLDMELAELDPSLRTPIAPKITPKVVRSQDQENPAFLPGTNNNSNSNNNSSNEKEQLSFINPKTGKVERSEAISKKDLEEVKRFQVLYPCYFDINRSHKEGRRVPKELAVENPLAKTMADAVRELGILCIFEGEKCHPQDFGNPGRIRVLFKENGQLIGAATKFKGGKRQLMKAVGEYMKRHPTTIESLREIPYGPDFDNIEFKKIPRVKGFKMNEIVPLHSPFLMGHPMTKSVYETPKITAAEKSFKPPKNKYKVVRR 4F4A6CBB9225E385 srp72-sec65-1 3 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 10 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 8 unspecified role unspecified role prey prey 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 northern blot northern blot northen weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain association association Fig1,Fig2 srp72-scr1 yeast-1 3 4 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 5 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 6 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed 7 unspecified role unspecified role bait bait over-expressed over expressed level over-expressed tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range 9 northern blot northern blot northen weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role prey prey In the absence of Srp54 and 65, ScR1 co-purificate with the complex, but the nuclease cleavage profile of ScR1 is different from the wild type. association association Fig1,Fig3 srp72_scr1-1 2 9 unspecified role unspecified role prey prey region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait tag protein a tag protein a tag protein A protein A c-term range C-terminal range c-term range c-term range C-terminal range c-term range physical association physical association Fig4 sec65-srp14-6 1 9 northern blot northern blot northen western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component C357G mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain C G A331G mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 8 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig6