IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Comparison of interleukin-22 and interleukin-10 soluble receptor complexes. Comparison of interleukin-22 and interleukin-10 soluble receptor complexes. Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2002 imex curation Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR., Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR. walter@uab.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR., Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR. walter@uab.edu Accepted 2015-DEC-01 AT 13:54 GMT AT 13:54 GMT by ORCHARD Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2002 imex curation I could not find in the Manual how to change it to insertion. This applies to: EBI-11302656 and EBI-11302227 Comparison of interleukin-22 and interleukin-10 soluble receptor complexes. Comparison of interleukin-22 and interleukin-10 soluble receptor complexes. Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2002 imex curation Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR., Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR. walter@uab.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR., Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR. walter@uab.edu Accepted 2015-DEC-01 AT 13:54 GMT AT 13:54 GMT by ORCHARD Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2002 imex curation I could not find in the Manual how to change it to insertion. This applies to: EBI-11302656 and EBI-11302227 Comparison of interleukin-22 and interleukin-10 soluble receptor complexes. Comparison of interleukin-22 and interleukin-10 soluble receptor complexes. Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2002 imex curation Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR., Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR. walter@uab.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR., Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR. walter@uab.edu Accepted 2015-DEC-01 AT 13:54 GMT AT 13:54 GMT by ORCHARD Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2002 imex curation I could not find in the Manual how to change it to insertion. This applies to: EBI-11302656 and EBI-11302227 Comparison of interleukin-22 and interleukin-10 soluble receptor complexes. Comparison of interleukin-22 and interleukin-10 soluble receptor complexes. Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2002 imex curation Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR., Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR. walter@uab.edu 19-Jan-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR., Logsdon NJ., Jones BC., Josephson K., Cook J., Walter MR. Biacore Interaction Kinetics - solution affinity measurement: IL10M1 (P22301), IL22(Q9GZX6) immobilized to a carboxylated dextran matrix (CM-5chip) using N-hydroxysuccinimide (NHS) and 3-(N,N-dimethylamino)propyl-N-ethylcarbodiimide (EDC) walter@uab.edu Accepted 2015-DEC-01 AT 13:54 GMT AT 13:54 GMT by ORCHARD Journal of interferon & cytokine research : the official journal of the International Society for Interferon and Cytokine Research 2002 imex curation I could not find in the Manual how to change it to insertion. This applies to: EBI-11302656 and EBI-11302227 il22_human Interleukin-22 IL22 ILTIF UNQ3099/PRO10096 ZCYTO18 IL-10-related T-cell-derived-inducible factor Cytokine Zcyto18 protein protein human Homo sapiens Human MAALQKSVSSFLMGTLATSCLLLLALLVQGGAAAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI DIP protein Q9GZX6 original sequence version: 74 DIP protein Q9GZX6 original sequence version: 95 Cytokine that contributes to the inflammatory response in vivo mint 3C35E64D60CF8767 i10r1_human Interleukin-10 receptor subunit alpha IL10RA IL10R Interleukin-10 receptor subunit 1 CDw210a protein protein human Homo sapiens Human MLPCLVVLLAALLSLRLGSDAHGTELPSPPSVWFEAEFFHHILHWTPIPNQSESTCYEVALLRYGIESWNSISNCSQTLSYDLTAVTLDLYHSNGYRARVRAVDGSRHSNWTVTNTRFSVDEVTLTVGSVNLEIHNGFILGKIQLPRPKMAPANDTYESIFSHFREYEIAIRKVPGNFTFTHKKVKHENFSLLTSGEVGEFCVQVKPSVASRSNKGMWSKEECISLTRQYFTVTNVIIFFAFVLLLSGALAYCLALQLYVRRRKKLPSVLLFKKPSPFIFISQRPSPETQDTIHPLDEEAFLKVSPELKNLDLHGSTDSGFGSTKPSLQTEEPQFLLPDPHPQADRTLGNREPPVLGDSCSSGSSNSTDSGICLQEPSLSPSTGPTWEQQVGSNSRGQDDSGIDLVQNSEGRAGDTQGGSALGHHSPPEPEVPGEEDPAAVAFQGYLRQTRCAEEKATKTGCLEEESPLTDGLGPKFGRCLVDEAGLHPPALAKGYLKQDPLEMTLASSGAPTGQWNQPTEEWSLLALSSCSDLGISDWSFAHDLAPLGCVAAPGGLLGSFNSDLVTLPLISSLQSSE DIP protein Q13651 original sequence version: 94 DIP protein Q13651 original sequence version: 93 54B183ABE84808DB i22r1_human Interleukin-22 receptor subunit alpha-1 IL22RA1 IL22R Cytokine receptor class-II member 9 Cytokine receptor family 2 member 9 ZcytoR11 protein protein human Homo sapiens Human MRTLLTILTVGSLAAHAPEDPSDLLQHVKFQSSNFENILTWDSGPEGTPDTVYSIEYKTYGERDWVAKKGCQRITRKSCNLTVETGNLTELYYARVTAVSAGGRSATKMTDRFSSLQHTTLKPPDVTCISKVRSIQMIVHPTPTPIRAGDGHRLTLEDIFHDLFYHLELQVNRTYQMHLGGKQREYEFFGLTPDTEFLGTIMICVPTWAKESAPYMCRVKTLPDRTWTYSFSGAFLFSMGFLVAVLCYLSYRYVTKPPAPPNSLNVQRVLTFQPLRFIQEHVLIPVFDLSGPSSLAQPVQYSQIRVSGPREPAGAPQRHSLSEITYLGQPDISILQPSNVPPPQILSPLSYAPNAAPEVGPPSYAPQVTPEAQFPFYAPQAISKVQPSSYAPQATPDSWPPSYGVCMEGSGKDSPTGTLSSPKHLRPKGQLQKEPPAGSCMLGGLSLQEVTSLAMEESQEAKSLHQPLGICTDRTSDPNVLHSGEEGTPQYLKGQLPLLSSVQIEGHPMSLPLQPPSRPCSPSDQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWES DIP protein Q8N6P7 original sequence version: 54 DIP protein Q8N6P7 original sequence version: 74 D46CC71D496F3420 i10r2_human Interleukin-10 receptor subunit beta IL10RB CRFB4 D21S58 D21S66 Cytokine receptor class-II member 4 Cytokine receptor family 2 member 4 Interleukin-10 receptor subunit 2 protein protein human Homo sapiens Human MAWSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSWMVAVILMASVFMVCLALLGCFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAEDSESGKQNPGDSCSLGTPPGQGPQS DIP protein Q08334 original sequence version: 95 E470726619AF54C2 il10_human Interleukin-10 IL10 Cytokine synthesis inhibitory factor protein protein human Homo sapiens Human MHSSALLCCLVLLTGVRASPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN DIP protein P22301 original sequence version: 115 6825E9FA4337CDE4 il22-il22ra1-2 3 5 unspecified role unspecified role neutral component neutral component drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 7 unspecified role unspecified role neutral component neutral component c-terminus il22r1 his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region il22r1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction Fig4. B Il-22 and IL-22r1 interact at 1:1 molar ratio. il22-3 4 5 unspecified role unspecified role bait bait drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 7 unspecified role unspecified role prey prey region IL22r sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus IL22r-s his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction Table 1, Fig.5 il22-6 1 9 unspecified role unspecified role bait bait P22301:p.Asn134delinsGlyGlyGlySerGlyGlyLys il10m1 mutation mutation certain certain sequence position certain certain certain sequence position certain N GGGSGGK Fri Jul 22 11:13:50 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asn134-134_gly_gly_gly_ser_gly_gly_lys' Wed May 02 17:26:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn134gly_gly_gly_ser_gly_gly_lys' Tue Jun 30 16:36:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn134delinsGlyGlyGlySerGlyGlyLys' drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 6 unspecified role unspecified role prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction Table. 1, Fig. 5. il22-4 1 5 unspecified role unspecified role prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 7 unspecified role unspecified role bait bait region il22r1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus IL22r his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction Fig. 6 C il22-5 1 5 unspecified role unspecified role bait bait drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 7 unspecified role unspecified role prey prey c-terminus il22r1 his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region il22r1 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 8 unspecified role unspecified role prey prey region il102 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association Fig. 7 C and D il10-il10ra-2 1 6 unspecified role unspecified role prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 8 unspecified role unspecified role prey prey n-terminus il10r2 his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region il10r2 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 9 unspecified role unspecified role bait bait P22301:p.Asn134_Lys135insGlyGlyGlySerGlyGlyLys il10m1 mutation mutation certain certain sequence position certain certain certain sequence position certain NK NGGGSGGKK Wed May 02 19:54:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asn134asn_gly_gly_gly_ser_gly_gly_lys' Tue Jun 30 15:44:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asn134_Lys135insGlyGlyGlySerGlyGlyLys' drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. physical association physical association Fig. 7 A and B il10-il10r1-1 3 6 unspecified role unspecified role neutral component neutral component drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 9 unspecified role unspecified role neutral component neutral component drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction Fig. 4B, Fig 6B A complex was observed at 1:2 molar ratio ( 2 IL-10:4 sIL-10R1). il22-il22ra1-1 4 5 unspecified role unspecified role bait bait drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 7 unspecified role unspecified role prey prey region IL22r sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminus IL22r-s his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction Table 1, Fig.6. il10-il10ra-3 4 9 unspecified role unspecified role bait bait undefined mutation il10m1 mutation mutation certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:55:31 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'asn134-134_gly_gly_gly_ser_gly_gly_lys' drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. 6 unspecified role unspecified role prey prey drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction Table. 1, Fig. 6. il10-il10ra-4 2 6 unspecified role unspecified role bait bait 9 unspecified role unspecified role prey prey region biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined enzymatic reaction enzymatic reaction Biochemical reaction Biochemical reaction Table 1 il10-1 3 9 unspecified role unspecified role neutral component neutral component drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. direct interaction direct interaction Fig. 2A