bhf-ucl A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. The EMBO journal 2000 imex curation Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro far western blotting far western blotting Affinity blotting Affinity blotting predetermined predetermined participant predetermined Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu Accepted 2016-JUL-11 AT 12:15 BST AT 12:15 BST by ORCHARD The EMBO journal 2000 imex curation A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. The EMBO journal 2000 imex curation Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions rat-liver rattus norvegicus liver Rat liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip antibody detection identification by antibody antibody detection Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease the complexes in rat liver cytosol were first purified by gel filtration. graham.warren@yale.edu Accepted 2016-JUL-11 AT 12:15 BST AT 12:15 BST by ORCHARD The EMBO journal 2000 imex curation A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. The EMBO journal 2000 imex curation Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions rat-liver rattus norvegicus liver Rat liver liver molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu Accepted 2016-JUL-11 AT 12:15 BST AT 12:15 BST by ORCHARD The EMBO journal 2000 imex curation A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. The EMBO journal 2000 imex curation Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions rat-liver rattus norvegicus liver Rat liver liver anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu Accepted 2016-JUL-11 AT 12:15 BST AT 12:15 BST by ORCHARD The EMBO journal 2000 imex curation A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. The EMBO journal 2000 imex curation Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro competition binding competition binding weight by comassie molecular weight estimation by coomasie staining weight by comassie Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease once the npl4-ufd1 complex is released on cp, then NC is to copy the interaction vcp-ufd1l-2 (EBI-11175498) and replace gst-ufd1 with this new complex (his-npl4:gst-ufd1) (lanes 18 to 20). complex cannot be released before this paper is released due to the exp-evid from this paper being needed for it. once the npl4-ufd1 complex is released on cp, then NC is to copy the interaction nsfl1c-vcp-10 (EBI-11175095) and replace his-ufd1 with this new complex (his-npl4:his-ufd1) (lanes 6 to 9). complex cannot be released before this paper is released due to the exp-evid from this paper being needed for it. graham.warren@yale.edu Accepted 2016-JUL-11 AT 12:15 BST AT 12:15 BST by ORCHARD The EMBO journal 2000 imex curation A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. The EMBO journal 2000 imex curation Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions rat-liver rattus norvegicus liver Rat liver liver pull down pull down fingerprinting peptide massfingerprinting fingerprinting Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease a doublet of 67 and 71 kDa was identified for Npl4. graham.warren@yale.edu Accepted 2016-JUL-11 AT 12:15 BST AT 12:15 BST by ORCHARD The EMBO journal 2000 imex curation A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. The EMBO journal 2000 imex curation Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu Accepted 2016-JUL-11 AT 12:15 BST AT 12:15 BST by ORCHARD The EMBO journal 2000 imex curation A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. A complex of mammalian ufd1 and npl4 links the AAA-ATPase, p97, to ubiquitin and nuclear transport pathways. The EMBO journal 2000 imex curation Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease graham.warren@yale.edu 04-Aug-2016: Contacted by IntAct-Help. Only protein-protein interactions rat-liver rattus norvegicus liver Rat liver liver pull down pull down western blot western blot Immuno blot Immuno blot Meyer HH., Shorter JG., Seemann J., Pappin D., Warren G. Parkinsons - Interactions investigated in the context of Parkinsons disease a doublet of 67 and 71 kDa was identified for Npl4. graham.warren@yale.edu Accepted 2016-JUL-11 AT 12:15 BST AT 12:15 BST by ORCHARD The EMBO journal 2000 imex curation tera_mouse Transitional endoplasmic reticulum ATPase Vcp 15S Mg(2+)-ATPase p97 subunit Valosin-containing protein protein protein mouse Mus musculus Mouse MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG DIP protein Q01853 original sequence version: 84 DIP protein Q01853 original sequence version: 112 DIP protein Q01853 original sequence version: 152 DIP protein Q01853 original sequence version: 136 DIP protein Q01853 original sequence version: 156 DIP protein Q01853 original sequence version: 149 501B721D3A77BA8A npl4_rat Nuclear protein localization protein 4 homolog Nploc4 Npl4 protein protein rat Rattus norvegicus (Rat) Rat MAESIIIRVQSPDGVKRITATKRETAATFLKKVAKEFGFQNNGFSVYINRNKTGEITASSSKSLHLLKIKHGDLLFLFPSSLAGPSSEMETSTSVGLKAFGAPHVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDEDYLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQPSAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEVAAIYEPPQIGTQNSLELLEDPKAEVVDEIASKLGLRKVGWIFTDLVSEDTRKGTVRYSRNKDTYFLSSEECITAGDFQNKHPNICRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQCMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDIDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNEVMPLQDSISLLLEAVRTRNEELAQTWKKSEQWATIEQLCSTVGVQLPGLHEFGAVGGSARAATSAMWACQHCTFMNQPGTGHCEMCSLPRT DIP protein Q9ES54 original sequence version: 87 DIP protein Q9ES54 original sequence version: 97 F6F57DDEA53594A3 ube4a_rat Ubiquitin conjugation factor E4 A Ube4a RING-type E3 ubiquitin transferase E4 A protein protein rat Rattus norvegicus (Rat) Rat MTDQENNNNISSNPFAALFGSLADAKQFAAIHKEQLKQQSDELPASPDDSDNSVSESLDEFDYSVSEISRSFRTHQEMCEQLNINHMIQRIFLITLDNSDPNLKSGNGIPSRCVYLEEMAVELEDQDWLDMSNVEQAIFARLLLQDPGNHLISMTSSATLNLSADRDAGERHIFCYLYSCFQRAKEEITKVPENLLPFAVQCRNLTVSNTRTVLLTPEIYVDQNIHEQLVDLMLEAIQGAHFEDVTEFLEEVIEALLLDEEVRTFPEVMIPVFDILLGRIKDLELCQILLYAYLDILLYFTRQKDMAKVFLEYIQPKDPSNGQMYQKTLLGVILNISCLLKTPGVVENHGFFLNPSRSSPQEIKVQEANIHQFMAQFHEKIYQMLKNLLQLSPETKHGILFWLGNCLHANAGRTKIWANQMPEIFFQMYASDAFFLNLGAALLKLCQPFCKPRSSRLLTFNPTYCVLKDLNDEERKIKSVHMRGLDKETCLIPAVQEPVFPQSYNLVTENLALTEYTLYLGFHRLHDQMVKINQNLHRLQVAWRDAQQSSSPAADNLREQFERLMTIYLSTKTAMTEPQMLQNCLNLQVSMAVLLVQLAIGNEGSQPIELSFPLPDGYSSLAYVPEFFADNLGDFLIFLRRFAEDILETSADSLEHVLHFITIFTGSIERMKNPHLRAKLAEVLEAVMPHLDQTPSPLVSSVFHRKRVFCNFPYAPQLSEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDSYRESIKDLADYASKNLEAMNPPLFLRFLNLLMNDAIFLLDEAIQYLSKIKIQQIEKDRGEWESLTPEARREKEAGLQMFGQLARFHNIMSNETIGTLSFLTSEIKSLFVHPFLAERIISMLNYFLQHLVGPKMGALKVKDFSEFDFKPQQLVSDICTIYLNLGDEENFCATVPKDGRSYSPTLFAQTVRVLKKINKPGNMIVAFSNLAERIKSLADLQQQEEETYADACDEFLDPIMSTLMSDPVVLPSSRVTVDGSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQKEQLE 0B54EAA379B4DAF6 ufd1_mouse Ubiquitin recognition factor in ER-associated degradation protein 1 Ufd1 Ubiquitin fusion degradation protein 1 homolog Ufd1l protein protein mouse Mus musculus Mouse MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFIAFSGEGQSLRKKGRKP DIP protein P70362 original sequence version: 80 DIP protein P70362 original sequence version: 88 mint homomint Essential component of the ubiquitin-dependent proteolytic pathway which degrades ubiquitin fusion proteins. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope (By similarity). It may be involved in the development of some ectoderm-derived structures C85E06B1B910485D nsf1c_rat NSFL1 cofactor p47 Nsfl1c p97 cofactor p47 XY body-associated protein XY40 protein protein rat Rattus norvegicus (Rat) Rat MAEERQDALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRGTAPSDNRVTSFRDLIHDQDEEEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGERRRHSGQDVHVVLKLWKTGFSLDNGDLRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTGEGQKLGSTAPQVLNTSSPAQQAENEAKASSSILINEAEPTTNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADENQTLKEANLLNAVIVQRLT 60C81402E5C58134 tera_rat Transitional endoplasmic reticulum ATPase Vcp 15S Mg(2+)-ATPase p97 subunit Valosin-containing protein protein protein rat Rattus norvegicus (Rat) Rat MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLKGKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPIDDTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDTVIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIGGLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFISIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRVINQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAMEVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGGAGPSQGSGGGTGGNVYTEDNDDDLYG 501B721D205EBA8A ufd1_rat Ubiquitin recognition factor in ER-associated degradation protein 1 Ufd1 Ubiquitin fusion degradation protein 1 homolog Ufd1l protein protein rat Rattus norvegicus (Rat) Rat MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPMVKKVEEDEAGGRFVAFSGEGQSLRKKGRKP C482D6B1B910494D vcp-nploc4-9 6 15 fingerprinting peptide massfingerprinting fingerprinting ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey 11 fingerprinting peptide massfingerprinting fingerprinting ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey 9 fingerprinting peptide massfingerprinting fingerprinting ms participant Identification by mass spectrometry ms participant unspecified role unspecified role bait bait his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 fingerprinting peptide massfingerprinting fingerprinting ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey 13 fingerprinting peptide massfingerprinting fingerprinting ms participant Identification by mass spectrometry ms participant unspecified role unspecified role prey prey association association figure 1a vcp-nploc4-2 7 12 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association figure 4a lane 3 in the panel on the right (entitlted 'bound') vcp-nploc4-1 7 12 unspecified role unspecified role prey prey purified purified GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role prey prey purified purified naturally occurring naturally occurring endogenous endogenous 10 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association figure 4b lane 3 in the panel on the right (entitlted 'bound') nploc4-ufd1l-1 7 12 unspecified role unspecified role bait bait purified purified GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association figure 4c lane 3 in the panel on the right (entitlted 'bound') vcp-nploc4-3 1 10 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction figure 4d lane 3 ufd1l-nploc4-1 1 12 unspecified role unspecified role prey prey his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction figure 4d lane 10 vcp-nploc4-4 1 12 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction figure 4d lane 4 vcp-ufd1l-1 1 13 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction figure 4d lane 5 vcp-nploc4-6 3 15 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component physical association physical association figure 5a nploc4-ufd1l-2 3 13 unspecified role unspecified role neutral component neutral component 14 unspecified role unspecified role neutral component neutral component physical association physical association figure 5a vcp-nploc4-7 2 15 antibody detection identification by antibody antibody detection western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait cell lysate cell lysate 14 antibody detection identification by antibody antibody detection western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate 10 antibody detection identification by antibody antibody detection western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate association association figure 5b ufd1l-nploc4-2 2 15 antibody detection identification by antibody antibody detection western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait cell lysate cell lysate 10 antibody detection identification by antibody antibody detection western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey cell lysate cell lysate physical association physical association figure 5b ufd1l-nploc4-3 4 14 antibody detection identification by antibody antibody detection western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association figure 6a ufd1l-nploc4-4 4 15 antibody detection identification by antibody antibody detection western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait 14 antibody detection identification by antibody antibody detection western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey 10 antibody detection identification by antibody antibody detection western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey association association figure 6a nploc4-ufd1l-3 4 15 unspecified role unspecified role prey prey 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait association association figure 6a nsfl1c-vcp-11 5 9 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction figure 6b left panel lanes 1, 5 and 9. vcp-nploc4-10 8 15 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous 9 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous 13 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous association association figure 1b vcp-ufd1l-3 7 12 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction figure 4a lane 2 in the panel on the right (entitlted 'bound') nploc4-ufd1l-6 7 12 unspecified role unspecified role prey prey purified purified GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction figure 4b lane 1 in the panel on the right (entitlted 'bound') ufd1l-vcp-1 7 12 unspecified role unspecified role bait bait purified purified GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction figure 4c lane 1 in the panel on the right (entitlted 'bound') ufd1l-nploc4-5 7 12 unspecified role unspecified role bait bait purified purified GST tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction figure 4c lane 2 in the panel on the right (entitlted 'bound') vcp-nploc4-5 1 10 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous rat-liver rattus norvegicus liver Rat liver liver 9 unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association figure 4d lane 2 nploc4-ufd1l-7 1 15 unspecified role unspecified role prey prey naturally occurring naturally occurring endogenous endogenous rat-liver rattus norvegicus liver Rat liver liver 10 unspecified role unspecified role bait bait purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) physical association physical association figure 4d lane 7 nsfl1c-vcp-10 5 12 competitor competitor competitor prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined npl4 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 10 competitor competitor competitor prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ufd1 binding region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 unspecified role unspecified role bait bait gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association figure 6b left panel lanes 2 to 4 nsfl1c-vcp-12 5 12 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association figure 6b right panel lane 13 vcp-ufd1l-2 5 12 unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 13 competitor competitor competitor prey prey his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) association association figure 6b right panel lanes 14 to 16