UniProt UniProt http://www.uniprot.org ZIP kinase, a novel serine/threonine kinase which mediates apoptosis. ZIP kinase, a novel serine/threonine kinase which mediates apoptosis. Mol. Cell. Biol. (0270-7306) 1998 imex curation Kawai T., Matsumoto M., Takeda K., Sanjo H., Akira S. akita@hyo.med.ac.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protein kinase assay protein kinase assay predetermined predetermined participant predetermined Kawai T., Matsumoto M., Takeda K., Sanjo H., Akira S. akita@hyo.med.ac.jp Accepted 2014-AUG-12 by ORCHARD Mol. Cell. Biol. (0270-7306) 1998 imex curation ZIP kinase, a novel serine/threonine kinase which mediates apoptosis. ZIP kinase, a novel serine/threonine kinase which mediates apoptosis. Mol. Cell. Biol. (0270-7306) 1998 imex curation Kawai T., Matsumoto M., Takeda K., Sanjo H., Akira S. akita@hyo.med.ac.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kawai T., Matsumoto M., Takeda K., Sanjo H., Akira S. akita@hyo.med.ac.jp Accepted 2014-AUG-12 by ORCHARD mouse brain cDNA Mol. Cell. Biol. (0270-7306) 1998 imex curation ZIP kinase, a novel serine/threonine kinase which mediates apoptosis. ZIP kinase, a novel serine/threonine kinase which mediates apoptosis. Mol. Cell. Biol. (0270-7306) 1998 imex curation Kawai T., Matsumoto M., Takeda K., Sanjo H., Akira S. akita@hyo.med.ac.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kawai T., Matsumoto M., Takeda K., Sanjo H., Akira S. akita@hyo.med.ac.jp Accepted 2014-AUG-12 by ORCHARD Mol. Cell. Biol. (0270-7306) 1998 imex curation ZIP kinase, a novel serine/threonine kinase which mediates apoptosis. ZIP kinase, a novel serine/threonine kinase which mediates apoptosis. Mol. Cell. Biol. (0270-7306) 1998 imex curation Kawai T., Matsumoto M., Takeda K., Sanjo H., Akira S. akita@hyo.med.ac.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Kawai T., Matsumoto M., Takeda K., Sanjo H., Akira S. akita@hyo.med.ac.jp Accepted 2014-AUG-12 by ORCHARD Mol. Cell. Biol. (0270-7306) 1998 imex curation ZIP kinase, a novel serine/threonine kinase which mediates apoptosis. ZIP kinase, a novel serine/threonine kinase which mediates apoptosis. Mol. Cell. Biol. (0270-7306) 1998 imex curation Kawai T., Matsumoto M., Takeda K., Sanjo H., Akira S. akita@hyo.med.ac.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Kawai T., Matsumoto M., Takeda K., Sanjo H., Akira S. akita@hyo.med.ac.jp Accepted 2014-AUG-12 by ORCHARD human placenta cDNA Mol. Cell. Biol. (0270-7306) 1998 imex curation dapk3_human Death-associated protein kinase 3 DAPK3 ZIPK DAP-like kinase Zipper-interacting protein kinase MYPT1 kinase protein protein human Homo sapiens Human MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRYEALAKQVASEMRFVQDLVRALEQEKLQGVECGLR 56773008A6A61CF0 dapk3_mouse Death-associated protein kinase 3 Dapk3 Zipk DAP-like kinase ZIP-kinase MYPT1 kinase protein protein mouse Mus musculus Mouse MSTFRQEDVEDHYEMGEELGSGQFAIVRKCQQKGTGMEYAAKFIKKRRLPSSRRGVSREEIEREVSILREIRHPNIITLHDVFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKHAASPRIKLIDFGIAHRIEAGSEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSSTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKVRRREDGARKPERRRLRAARLREYSLKSHSSMPRNTSYASFERFSRVLEDVAAAEQGLRELQRGRRQCRERVCALRAAAEQREARCRDGSAGLGRDLRRLRTELGRTEALRTRAQEEARAALLGAGGLKRRLCRLENRYDALAAQVAAEVQFVRDLVRALEQERLQAECGVR DA32EF3EB1F20EFC atf4_human Cyclic AMP-dependent transcription factor ATF-4 Activating transcription factor 4 CREB2 ATF4 TXREB Cyclic AMP-responsive element-binding protein 2 Tax-responsive enhancer element-binding protein 67 protein protein human Homo sapiens Human MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP 3BBB7379DC3B0D07 DIP protein P18848 original sequence version: 181 DIP protein P18848 original sequence version: 117 No Uniprot Update and Caution removed " The protein could not be merged with EBI-12907955 because of some conflicts with the protein sequence (features which cannot be shifted)." -EBI-12907955 no longer exists. 3BBB7379DC3B0D07 atf4_mouse Cyclic AMP-dependent transcription factor ATF-4 Atf4 C/EBP-related ATF Activating transcription factor 4 Creb2 Cyclic AMP-responsive element-binding protein 2 protein protein mouse Mus musculus Mouse MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLKPHGFSSDKAGSSEWPAMDDGLASASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDLETMPDELLTTLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESLIKVDQVAPFTFLQPFPCSPGVLSSTPEHSFSLELGSEVDISEGDRKPDSAAYITLIPPCVKEEDTPSDNDSGICMSPESYLGSPQHSPSTSRAPPDNLPSPGGSRGSPRPKPYDPPGVSLTAKVKTEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVRKARGKKRVP DIP protein Q06507 original sequence version: 77 DIP protein Q06507 original sequence version: 105 0C3F895755B1C7B9 atf4-dapk3 2 9 unspecified role unspecified role bait bait basic-leucine zipper domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey physical association physical association no figure atf4-dapk3-2 5 6 unspecified role unspecified role prey prey 9 unspecified role unspecified role bait bait basic-leucine zipper domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association no figure dapk3-atf4-1 3 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4 atf4-dapk3-3 3 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 4 atf4-dapk3-4 4 7 unspecified role unspecified role prey prey O54784:p.[Val422Ala;Val429Ala;Leu436Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:52:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val422ala,val429ala,leu436ala' Tue Jun 30 17:53:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val422Ala;Val429Ala;Leu436Ala]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 9 unspecified role unspecified role bait bait basic-leucine zipper domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association 5 dapk3-dapk3-1 4 7 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O54784:p.[Val422Ala;Val429Ala;Leu436Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 15:52:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val422ala,val429ala,leu436ala' Tue Jun 30 18:42:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val422Ala;Val429Ala;Leu436Ala]' 40 38 physical association physical association 6 dapk3-3 1 7 putative self putative self putative self putative self region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O54784:p.Lys42Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain K A Wed May 02 19:07:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys42ala' Tue Jun 30 18:30:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys42Ala' O54784:p.[Val422Ala;Val429Ala;Leu436Ala] mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain V A certain certain sequence position certain certain certain sequence position certain L A Wed May 02 16:47:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val422ala,val429ala,leu436ala' Tue Jun 30 19:15:18 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val422Ala;Val429Ala;Leu436Ala]' chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 phosphorylation phosphorylation reaction phosphorylation true 7