MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Arabidopsis STAYGREEN-LIKE (SGRL) promotes abiotic stress-induced leaf yellowing during vegetative growth. Arabidopsis STAYGREEN-LIKE (SGRL) promotes abiotic stress-induced leaf yellowing during vegetative growth. FEBS Lett. (0014-5793) 2014 imex curation Sakuraba Y., Kim D., Kim Y.S., Hörtensteiner S., Paek N.C. sakuraba0425@gmail.com or ncpaek@snu.ac.kr 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined sakuraba0425@gmail.com or ncpaek@snu.ac.kr Accepted 2014-SEP-08 by LUANA 2014 imex curation Arabidopsis STAYGREEN-LIKE (SGRL) promotes abiotic stress-induced leaf yellowing during vegetative growth. Arabidopsis STAYGREEN-LIKE (SGRL) promotes abiotic stress-induced leaf yellowing during vegetative growth. FEBS Lett. (0014-5793) 2014 imex curation Sakuraba Y., Kim D., Kim Y.S., Hörtensteiner S., Paek N.C. sakuraba0425@gmail.com or ncpaek@snu.ac.kr 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot sakuraba0425@gmail.com or ncpaek@snu.ac.kr Accepted 2014-SEP-08 by LUANA 2014 imex curation nol_arath Chlorophyll(ide) b reductase NOL, chloroplastic NOL Protein NON-YELLOW COLORING 1-LIKE Short-chain dehydrogenase/reductase NOL MUG13.25 At5g04900 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATWSGFNVSSSPLLRLRSSSVSNVTKLPFLSPICRRRLLAERFGLATVVVTRQNLTVTPSSAAVEARISGKREPMTPPYNILITGSTKGIGYALAREFLKAGDNVVICSRSAERVETAVQSLKEEFGEHVWGTKCDVTEGKDVRELVAYSQKNLKYIDIWINNAGSNAYSFKPLAEASDEDLIEVVKTNTLGLMLCCREAMNMMLTQSRGGHIFNIDGAGSDGRPTPRFAAYGATKRSVVHLTKSLQAELQMQDVKNVVVHNLSPGMVTTDLLMSGATTKQAKFFINVLAEPAEVVAEYLVPNIRAIPASGSMKPTYIRFLTGIKAYTKIFSRVALGARKNRYVTEE B008E8957D3B2CB7 pao_arath Pheophorbide a oxygenase, chloroplastic PAO ACD1 Accelerated cell death 1 Lethal leaf-spot 1 homolog F28D10_70 At3g44880 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSVVLLSSTSATITKSQSKKIPFLSPTTKFPLKVSISPSRSKLFHNPLRVAAPPSVPTSDSTEEKRIEEEYGGDKEEEGSEFKWRDHWYPVSLVEDLDPNVPTPFQLLGRDLVLWFDRNDQKWAAFDDLCPHRLAPLSEGRLDENGHLQCSYHGWSFGGCGSCTRIPQAATSGPEARAVKSPRACAIKFPTMVSQGLLFVWPDENGWDRANSIEPPRLPDDFDKPEFSTVTIQRDLFYGYDTLMENVSDPSHIDFAHHKVTGRRDRAKPLPFKVESSGPWGFQGANDDSPRITAKFVAPCYSMNKIELDAKLPIVGNQKWVIWICSFNIPMAPGKTRSIVCSARNFFQFSVPGPAWWQVVPRWYEHWTSNLVYDGDMIVLQGQEKVFLAKSMESPDYDVNKQYTKLTFTPTQADRFVLAFRNWLRRHGKSQPEWFGSTPSNQPLPSTVLTKRQMLDRFDQHTQVCSSCKGAYNSFQILKKFLVGATVFWAATAGVPSDVQIRLVLAGLSLISAASAYALHEQEKNFVFRDYVHSEIE 61C86A08A00D8940 sgr2_arath Magnesium dechelatase SGR2, chloroplastic Protein NONYELLOWING 2 Protein STAY-GREEN 2 SGR2 NYE2 SGN2 Protein STAYGREEN 2 T26M18.120 At4g11910 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MCSLATNLLLPSKMKPVFPEKLSTSSLCVTTRRSKMKNRSIVPVARLFGPAIFEASKLKVLFLGVDEKKHPAKLPRTYTLTHSDITAKLTLAISQSINNSQLQGWANKLFRDEVVGEWKKVKGKMSLHVHCHISGGHFFLNLIAKLRYYIFCKELPVVLEAFAHGDEYLLNNHPELQESPVWVYFHSNIPEYNKVECWGPLWEAMSQHQHDGRTHKKSETLPELPCPDECKCCFPTVSTIPWSHRHYQHTAADENVADGLLEIPNPGKSKG D852EBB81756F32B rccr_arath Red chlorophyll catabolite reductase, chloroplastic RCCR ACD2 Accelerated cell death protein 2 C7A10_360 At4g37000 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAMIFCNTLYSSSSPSYLSPLTSKPSRFSKNLRPRAQFQSMEDHDDHLRRKFMEFPYVSPTRKQLMVDLMSTVENRLQSQLLPCNLPPDVRNFNNPNGSAEASLHIRSGDKSSPIDFVIGSWIHCKIPTGVSLNITSISGFLNSSTKAPNFVVELIQSSSKSLVLILDLPHRKDLVLNPDYLKEYYQDTALDSHRQSLLKLPEVNPYVSPSLFVRSAFSPTASMLKIDAEEEDKLEEILRDHVSPAAKEVLEVWLERCVKEEEEKIVVGEEERMELERRDKSFRRKSIEDDLDLQFPRMFGEEVSSRVVHAIKEAFGVL A46DC65FB7452517 sgr1_arath Magnesium dechelatase SGR1, chloroplastic Protein NONYELLOWING 1 Protein STAY-GREEN 1 SGR1 NYE1 SGN1 Protein STAYGREEN 1 F7H19.100 At4g22920 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MCSLSAIMLLPTKLKPAYSDKRSNSSSSSSLFFNNRRSKKKNQSIVPVARLFGPAIFESSKLKVLFLGVDEKKHPSTLPRTYTLTHSDITAKLTLAISQSINNSQLQGWANRLYRDEVVAEWKKVKGKMSLHVHCHISGGHFLLDLFAKFRYFIFCKELPVVLKAFVHGDGNLLNNYPELQEALVWVYFHSNVNEFNKVECWGPLWEAVSPDGHKTETLPEARCADECSCCFPTVSSIPWSHSLSNEGVNGYSGTQTEGIATPNPEKL 1B3F128F18EA79B2 nyc1_arath Probable chlorophyll(ide) b reductase NYC1, chloroplastic NYC1 Protein NON-YELLOW COLORING 1 F17N18.140 At4g13250 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTTLTKIQVYPQVLEHRLFFRDPIRVGSRLTCRERSNRVYVHRCEKKVERKRKVEKFKGNGSWDSLKSGFLGFSKLGFLSKDEYNQKVENLEMVFSSVAVQIARYIVTMTSTGAILLIGFQLSGGDSSMNSLVWYSWLGGIIIGTMTGANMVLEDHYRAGPRNVVITGSTRGLGKALAREFLLSGDRVIVTSRSSESVDMTVKELEQNLKEIMSNASESARKKLSDAKVVGIACDVCKPEDVEKLSNFAVKELGSINIWINNAGTNKGFRPLLEFTEEDITQIVSTNLIGSILCTRGAMDVMSRQHSGGHIFNMDGAGSGGSSTPLTAVYGSTKCGLRQFHGSIVKESQKTNVGLHTASPGMVLTELLLSGSSIKNKQMFNIICELPETVARTLVPRMRVVKGSGKAVNYLTPPRILLAIVTSWLRRGRWFDDQGRALYAAEADRLRNWAENRTRLSLTDAMEMYTENTWVSVFSLSVVCAFIILQSTTPSSFPGT 9174A2DF927565BF sgrl_arath Magnesium dechelatase SGRL, chloroplastic Protein STAY-GREEN LIKE F9C16.20 At1g44000 SGRL protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MACYIVPYYHHPVLSHPNREIFSHRHHHHHRFCNNLLNRRISVPRSSAISDGGVSYNTLVSEAVRLLVPQANFDSSKLKVEFLGELLENKSNGGIITPRTYILSHCDFTANLTLTISNVINLDQLEGWYKKDDVVAEWKKVNDELRLHIHCCVSGMSLLQDVAAELRYHIFSKELPLVLKAVVHGDSVMFRENPELMDAYVWVYFHSSTPKYNRIECWGPLKDAAKGKQQGNHQGFLSSTTSRKLIRHKSIFHTLFTFLL A0A75BCF7A145C00 hcar_arath 7-hydroxymethyl chlorophyll a reductase, chloroplastic HCAR HMCR T1G11.13 At1g04620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MITVVTSRLSLLPPVFSVVNSSSSRSKDMNLEPKKKVKLREDWREKSRPIPPGGTYPAKDHCSQCGLCDTYYIAHVKEACAFLGDGMSRIESLEPVVHGRGRKADSLQDTYFGVHQEQLYARKLKPVEGAQWTGIVTTIAIEMLKSNMVEAVVCVQSDPEDRLSPRPVLARTPEEVLAARGVKPTLSPNLNTLELIEASGVKRLLFCGVGCQVQALRSVEQHLNLEKLYVLGTNCVDNGTRDGLDKFLKAASKEPETVLHYEFMQDYKVQLKHLDGHIEEVPYFSLPANDLVDVIAPSCYSCFDYTNALADLVIGYMGVPKYSGLNMTDHPQYITVRNERGKEMLSLVENLLEITPTISSGDRRPFVTETVKADDAAKFGQGPAQPAPLFVGNIIAFILNLVGPKGLEFARYSLDYHTIRNYLYVNRKWGKQRANTHMPSYAKKIVEMYNKNGQIDKMLSKK 71DB353FB5DB1AA5 nol-nyc1 2 SGRL 9 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NOL 3 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level RCCR 6 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PAO 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level NCY1 8 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f4e rccr-sgrl 1 SGRL 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined RCCR 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4d sgrl-rccr 1 SGRL 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NOL 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4d sgrl-nol 1 HCAR 10 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SGRL 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4d sgrl-nol-1 2 NCY1 8 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level SGR1 7 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined NOL 3 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PAO 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level RCCR 6 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f4e sgr1-sgrl 2 SGRL 9 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SGR1 7 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5a sgr1-sgrl-1 2 SGRL 9 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SGR2 5 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5b sgr2-sgrl 2 SGRL 9 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined SGRL 9 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate flag tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f5c