MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Ultra-high resolution crystal structure of recombinant caprine β-lactoglobulin. Ultra-high resolution crystal structure of recombinant caprine β-lactoglobulin. FEBS Lett. (0014-5793) 2014 imex curation Crowther J.M., Lassé M., Suzuki H., Kessans S.A., Loo T.S., Norris G.E., Hodgkinson A.J., Jameson G.B., Dobson R.C. renwick.dobson@canterbury.ac.nz 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined renwick.dobson@canterbury.ac.nz Accepted 2014-SEP-03 by LUANA 2014 imex curation Ultra-high resolution crystal structure of recombinant caprine β-lactoglobulin. Ultra-high resolution crystal structure of recombinant caprine β-lactoglobulin. FEBS Lett. (0014-5793) 2014 imex curation Crowther J.M., Lassé M., Suzuki H., Kessans S.A., Loo T.S., Norris G.E., Hodgkinson A.J., Jameson G.B., Dobson R.C. renwick.dobson@canterbury.ac.nz 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined renwick.dobson@canterbury.ac.nz Accepted 2014-SEP-03 by LUANA 2014 imex curation Ultra-high resolution crystal structure of recombinant caprine β-lactoglobulin. Ultra-high resolution crystal structure of recombinant caprine β-lactoglobulin. FEBS Lett. (0014-5793) 2014 imex curation Crowther J.M., Lassé M., Suzuki H., Kessans S.A., Loo T.S., Norris G.E., Hodgkinson A.J., Jameson G.B., Dobson R.C. renwick.dobson@canterbury.ac.nz 20-Oct-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined renwick.dobson@canterbury.ac.nz Accepted 2014-SEP-03 by LUANA 2014 imex curation lacb_bovin Beta-lactoglobulin LGB protein protein bovin Bos taurus (Bovine) Bovine MKCLLLALALTCGAQALIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI DIP protein P02754 original sequence version: 80 225F10A78C63A6B2 lacb_caphi Beta-lactoglobulin LGB protein protein goat Capra hircus Goat MKCLLLALGLALACGIQAIIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGNLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDKEALEKFDKALKALPMHIRLAFNPTQLEGQCHV C2449BB02A1A80F1 lgb 1 cBlg 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f2b f2c lgb-1 1 bBlg 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f2b f2c lgb-1 3 cBlg 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f3 t1 lgb-1 2 cBlg 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction f4 t2