IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. EMBO J. (0261-4189) 2014 imex curation Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain-cortex Mus musculus brain cortex brain_cortex Brain cortex [Cerebral cortex; Cerebrum cortex; Cortex; Pallium] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov Accepted 2015-JAN-29 by ORCHARD EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. EMBO J. (0261-4189) 2014 imex curation Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip sequence tag sequence tag identification sequence tag Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov Accepted 2015-JAN-29 by ORCHARD EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. EMBO J. (0261-4189) 2014 imex curation Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov Accepted 2015-JAN-29 by ORCHARD EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. EMBO J. (0261-4189) 2014 imex curation Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov Accepted 2015-JAN-29 by ORCHARD EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. EMBO J. (0261-4189) 2014 imex curation Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov Accepted 2015-JAN-29 by ORCHARD EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. EMBO J. (0261-4189) 2014 imex curation Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-brain_hippocampal_neuron Mus musculus, brain, hippocampal neurons brain-hippocampus_neuron Hippocampal neuron confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov Accepted 2015-JAN-29 by ORCHARD EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. EMBO J. (0261-4189) 2014 imex curation Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov Accepted 2015-JAN-29 by ORCHARD EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. EMBO J. (0261-4189) 2014 imex curation Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-fibroblast Mus musculus fibroblast Fibroblast confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov Accepted 2015-JAN-29 by ORCHARD EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. Leucine-rich repeat kinase 2 regulates Sec16A at ER exit sites to allow ER-Golgi export. EMBO J. (0261-4189) 2014 imex curation Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Cho H.J., Yu J., Xie C., Rudrabhatla P., Chen X., Wu J., Parisiadou L., Liu G., Sun L., Ma B., Ding J., Liu Z., Cai H. Parkinsons - Interactions investigated in the context of Parkinsons disease email sent 18/12 - regarding GST -LRRK2 length and ROC domain numbering The (Cookson donated) Wt Myc-LRRK2 plasmid has been entered as details given for Addgene plasmid No:25361; mutant plasmid details have also been taken from the Addgene site. The authors have stated that the GST-LRRK2 construct was amino acids 970-2527; a recombinant protein expressed in Baculovirus, from Life Technologies. The authors have stated that Myc-tagged LRRK2 ROC construct was from Mark Cookson’s group, but unfortunately, they do not have the exact sequence information. zhihualiu@ibp.ac.cn,caih@mail.nih.gov Accepted 2015-JAN-29 by ORCHARD EMBO J. (0261-4189) 2014 Only protein-protein interactions imex curation lrrk2_human Leucine-rich repeat serine/threonine-protein kinase 2 LRRK2 PARK8 Dardarin protein protein human Homo sapiens Human MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSERASKLFQGKNIHVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILKMLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVEVLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQQYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWHRKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASANALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIMAAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKNDIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQEIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSASFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQNNSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIGKGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLARMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEGSFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLRSSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQNALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNHISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRSLDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQIRDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPKHPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYGCAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHHNSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQSGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTVKLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRTSQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKENKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMTAQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEKMRRTSVE DIP protein Q5S007 original sequence version: 36 DIP protein Q5S007 original sequence version: 68 DIP protein Q5S007 original sequence version: 64 26142A0CECBBC3F4 p55735-1 Protein SEC13 homolog GATOR complex protein SEC13 SEC13 D3S1231E SEC13L1 SEC13R SEC13-like protein 1 SEC13-related protein SEC13A protein protein human Homo sapiens Human MVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ DIP protein P55735-1 original sequence version: 128 DIP protein P55735 original sequence version: 97 18E29627D87FB3DD sc16a_mouse Protein transport protein Sec16A Sec16a Kiaa0310 SEC16 homolog A Sec16 protein protein mouse Mus musculus Mouse MQPPPQAVPSGVAGPPPAGNPRSMFWANSPYRKPANNAPVAPITRPLQPVTDPFAFNRQTLQNTPVGSSSKSSLPNLPGPALSVFSQWPGLPVTPTNAGDSSTGLHEPLSGTLSQPRADASLFPPASTPSSLPGLEVSRNAEADPSSGHEVQMLPHSAHYIPGVGPEQPLGGQMNDSGSGPDQPMNRHAPHDGAVTHAASPFLPQPQMPGQWGPAQGGPQPSYQHHSPYLEGPVQNMGLQAASLPHFPPPSSLHQGPGHESHAPQTFTPASLASGEGNEIVHQQSKNHPLSSFPPKHTFEQNSRIGNMWASPELKQNPGVNKEHLLDPAHVNPFTQGNSPENQAHHPPVAATNHALQEAASGALSMFFQGEETENEENLSSEKAGLDKRLNLDSFSSTSRLGHPPPPGASGVYQAFPRGPSSEAAQEGDAQPYFSQSVGVRLDKQSTVPPANDAWGDVPGTGTRCASGPQCENVENLEFVQNQEVLPRETLSVDPFPLSDQIRYGPLPGPAASRPATVGLTRGGGLNLEAPDTPLHPTRPDSVSSSYSSHSHRSPPGSARPQELVGTFIQQEVGKLEDDTSGSFFKQIDSSPVGGETDEVTGSQNCCSSLSQPSTPSPPKPTGVFQTSANSSFEPVKSHLVGVKPVEADRANMVVEVRGTQYCPKKRRAAVAPPDATSGNLEQPPDNMETPCAPQACPLPLSTTGEAGQLVSNTAGTPLDTVRPVPDKRPSARAQGPVKCESPATTLWAQNELPDFGGNVLLAPAAPALYVPVKPKPSEVVHHPEKGMSGQKAWKQGSVPPLQNQDPPGASENLENPPKVGEEEALPVQASSGYASLLSSPPTESLHNQPVLIAQPDQSYNLAQPINFSVSLLNPNEKNQSWGDAVVGERSIVSNNWALGGDPEERAALSGVPASAVTGASLPSSIPQNCAPQGSGSSEMIASQSASWLVQQLSPQTPQSPHPNAEKGPSEFVSSPAGNTSVMLVPPASSTLVPNSNKAKHSSNQEEAVGALDFTLNRTLENPVRMYSPSPSDGPASQQPLPNHPRQSGPGLHNQDHFYQQVTKDAQDQHRLERAQPELVPPRPQNSPQVPQASCPEPSNPESPPTQGQSESLAQPPASPASVNTGQLLPQPPQASSASVTSTNSSQAAVRSEQLWLHPPPPNTFGPAPQDLASYYYYRPLYDAYQSQYPSPYPSDPGTASLYYQDMYGLYEPRYRPYDSSASAYAENHRYSEPERPSSRASHYSDQLAPRQGYPEGYYNSKSGWSSHSDYYANYYSGQYDYGDPSRWDRYYGSRLRDPRTWDRRYWYDSEHDPYRKDHYAYSDRPEKCDDHWRYDPRFTGSFDDDAEIHRDPYGEEADRRSIHSEHSARSLRSTHSLPSRRSSLSSHSHQSQIYRSHHVTGGSFEAPHAPGSFHGDYAYGTYASNFSGAHGFPEYSYPADTSWPAVEQVPSRPTSPEKFTVPHVCARFGPGGQLLKVIPNLPSEGQPALVEIHSLETLLQHTPEQEEMRSFPGPLGKDDTHKVDVINFAQNKATKCLQNESLIDKESASLLWKFIILLCRQNGTVVGTDIAELLLRDHRTVWLPGKSPNEANLIDFTNEAVEQVEEEESGEAQLSFLTDSQTVTTSVLEKETERFRELLLYGRKKDALESAMKNGLWGHALLLASKMDSRTHARVMTRFANSLPINDPLQTVYQLMSGRMPAASTCCGDEKWGDWRPHLAMVLSNLNNNMDVESRTMATMGDTLASKGLLDAAHFCYLMAQVGFGVYTKKTTKLVLIGSNHSLPFLKFATNEAIQRTEAYEYAQSLGAHTCSLPNFQVFKFIYLCRLAEMGLATQAFHYCEVIAKSVLTQPGAYSPVLISQLTQMASQLRLFDPQLKEKPEEESFVEPAWLVQLQHVERQIQEGTVLWSQDGTEPQQCRITSGSEVEQSDGPGLNQQAGPQADNPLLMPSTEPLMHGVQLLPTAPQTLPDGQPAHLSRVPMFPVPMSRGPLELSPAYGPPGSALGFPESSRSDPAVLHPGQALPPTTLSLQESGLPPQEAKSPDPEMVPRGSPVRHSPPELSQEEFGESFADPGSSRTAQDLETSPVWDLGSSSLTRAPSLTSDSEGKKPAQAVKKEPKEPKKTESWFSRWLPGKKRTEAYLPDDKNKSIVWDEKKNQWVNLNEPEEEKKAPPPPPTSFPRVPQVAPTGPAGPPTASVNVFSRKAGGSRARYVDVLNPSGTQRSEPALAPADFFAPLAPLPIPSNLFVPNPDAEEPQPADGTGCRGQAPAGTQSKAESTLEPKVGSSTVSAPGPELLPSKPDGSQGGEAPGDHCPTGAPHGGSVPFYNPAQLVQASVTSGNSRPGRIGQRKYAALN BF482E74AEFD7157 lrrk2_mouse Leucine-rich repeat serine/threonine-protein kinase 2 Lrrk2 protein protein mouse Mus musculus Mouse MASGACQGCEEEEEEEALKKLIVRLNNVQEGKQIETLLQLLEDMLVFTYSDRASKLFEDKNFHVPLLIVLDSYMRVASVQQAGWSLLCKLIEVCPGTLQSLIGPQDIGNDWEVLGIHRLILKMLTVHHANVNLSIVGLKALDLLLDSGKLTLLILDEECDIFLLIFDAMHRYSANDEVQKLGCKALHVLFERVSEEQLTEFVENKDYTILLSTFGSFRRDKEIVYHVLCCLHSLAVTCSNVEVLMSGNVRCYNLVVEAMKAFPTNENIQEVSCSLFQKLTLGNFFNILVLNEVHVFVVKAVRQYPENAALQISALSCLALLTETIFLNQDLEERSETQEQSEEEDSEKLFWLEPCYKALVRHRKDKHVQEAACWALNNLLMYQNSLHEKIGDEDGQFPAHREVMLSMLMHSSSKDVFQAAAHALSTLLEQNVNFRKILLAKGVYLNVLELMQKHAHAPEVAESGCKMLSHLFEGSNPSLDTMAAVVPKILTVMKAHGTSLSVQLEALRAILHFVVPGLLEESREDSQCRPNVLRKQCFRTDIHKLVLVALNRFIGNPGIQKCGLKVISSLAHLPDATETLSLQGAVDSVLHTLQMYPDDQEIQCLGLHLMGCLMTKKNFCIGTGHLLAKILASTLQRFKDVAEVQTTGLQTTLSILELSVSFSKLLVHYSFDVVIFHQMSSSVVEQKDEQFLNLCCKCFAKVAVDDELKNTMLERACDQNNSIMVECLLLLGADANQVKGATSLIYQVCEKESSPKLVELLLNGGCREQDVRKALTVSIQKGDSQVISLLLRKLALDLANNSICLGGFGIGKIDPSWLGPLFPDKSSNLRKQTNTGSVLARKVLRYQMRNTLQEGVASGSDGKFSEDALAKFGEWTFIPDSSMDSVFGQSDDLDSEGSESSFLVKRKSNSISVGEVYRDLALQRCSPNAQRHSNSLGPVFDHEDLLRRKRKILSSDESLRSSRLPSHMRQSDSSSSLASEREHITSLDLSANELKDIDALSQKCCLSSHLEHLTKLELHQNSLTSFPQQLCETLKCLIHLDLHSNKFTSFPSFVLKMPRITNLDASRNDIGPTVVLDPAMKCPSLKQLNLSYNQLSSIPENLAQVVEKLEQLLLEGNKISGICSPLSLKELKILNLSKNHIPSLPGDFLEACSKVESFSARMNFLAAMPALPSSITSLKLSQNSFTCIPEAIFSLPHLRSLDMSHNNIECLPGPAHWKSLNLRELIFSKNQISTLDFSENPHVWSRVEKLHLSHNKLKEIPPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDGLHLNFDFKHVGCKAKDIIRFLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKMKKPELGMQGATVGIDVRDWSIQIRGKRRKDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKARASSSPVILVGTHLDVSDEKQRKACISKITKELLNKRGFPTIRDYHFVNATEESDALAKLRKTIINESLNFKIRDQPVVGQLIPDCYVELEKIILSERKAVPTEFPVINRKHLLQLVNEHQLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKVMAQILTVKVDGCLKHPKGIISRRDVEKFLSKKKRFPKNYMMQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVIELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPFMLSGRERALRPNRMYWRQGIYLNWSPEAYCLVGSEVLDNRPESFLKITVPSCRKGCILLGRVVDHIDSLMEEWFPGLLEIDICGEGETLLKKWALYSFNDGEEHQKILLDELMKKAEEGDLLINPDQPRLTIPISQIAPDLILADLPRNIMLNNDELEFEEAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQELVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVADGLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRAPEVARGNVIYNQQADVYSFGLLLHDIWTTGSRIMEGLRFPNEFDELAIQGKLPDPVKEYGCAPWPMVEKLITKCLKENPQERPTSAQVFDILNSAELICLMRHILIPKNIIVECMVATNLNSKSATLWLGCGNTEKGQLSLFDLNTERYSYEEVADSRILCLALVHLAAEKESWVVCGTQSGALLVINVEEETKRHTLEKMTDSVTCLHCNSLAKQSKQSNFLLVGTADGNLMIFEDKAVKCKGAAPLKTLHIGDVSTPLMCLSESLNSSERHITWGGCGTKVFSFSNDFTIQKLIETKTNQLFSYAAFSDSNIIALAVDTALYIAKKNSPVVEVWDKKTEKLCELIDCVHFLKEVMVKLNKESKHQLSYSGRVKALCLQKNTALWIGTGGGHILLLDLSTRRVIRTIHNFCDSVRAMATAQLGSLKNVMLVLGYKRKSTEGIQEQKEIQSCLSIWDLNLPHEVQNLEKHIEVRTELADKMRKTSVE DIP protein Q5S006 original sequence version: 57 706E25C173E36F98 sc16a_human Protein transport protein Sec16A KIAA0310 SEC16 SEC16L SEC16 homolog A SEC16A protein protein human Homo sapiens Human MQPPPQTVPSGMAGPPPAGNPRSVFWASSPYRRRANNNAAVAPTTCPLQPVTDPFAFSRQALQSTPLGSSSKSSPPVLQGPAPAGFSQHPGLLVPHTHARDSSQGPCEPLPGPLTQPRAHASPFSGALTPSAPPGPEMNRSAEVGPSSEPEVQTLPYLPHYIPGVDPETSHGGHPHGNMPGLDRPLSRQNPHDGVVTPAASPSLPQPGLQMPGQWGPVQGGPQPSGQHRSPCPEGPVPSGVPCATSVPHFPTPSILHQGPGHEQHSPLVAPPAALPSDGRDEVSHLQSGSHLANNSDPESTFRQNPRIVNHWASPELRQNPGVKNEHRPASALVNPLARGDSPENRTHHPLGAGAGSGCAPLEADSGASGALAMFFQGGETENEENLSSEKAGLSGQADFDDFCSSPGLGRPPAPTHVGAGSLCQALLPGPSNEAAGDVWGDTASTGVPDASGSQYENVENLEFVQNQEVLPSEPLNLDPSSPSDQFRYGPLPGPAVPRHGAVCHTGAPDATLHTVHPDSVSSSYSSRSHGRLSGSARPQELVGTFIQQEVGKPEDEASGSFFKQIDSSPVGGETDETTVSQNYRGSVSQPSTPSPPKPTGIFQTSANSSFEPVKSHLVGVKPFEADRANVVGEVRETCVRQKQCRPAAALPDASPGNLEQPPDNMETLCAPQVCPLPLNSTTEAVHMLPHAGAPPLDTVYPAPEKRPSARTQGPVKCESPATTLWAQSELPDFGGNVLLAPAAPALYVCAKPQPPVVQPPEEAMSGQQSRNPSSAAPVQSRGGIGASENLENPPKMGEEEALQSQASSGYASLLSSPPTESLQNPPVLIAQPDHSYNLAQPINFSVSLSNSHEKNQSWREALVGDRPAVSSWALGGDSGENTSLSGIPTSSVLSLSLPSSVAQSNFPQGSGASEMVSNQPANLLVQPPSQPVPENLVPESQKDRKAGSALPGFANSPAGSTSVVLVPPAHGTLVPDGNKANHSSHQEDTYGALDFTLSRTLENPVNVYNPSHSDSLASQQSVASHPRQSGPGAPNLDRFYQQVTKDAQGQPGLERAQQELVPPQQQASPPQLPKAMFSELSNPESLPAQGQAQNSAQSPASLVLVDAGQQLPPRPPQSSSVSLVSSGSGQAAVPSEQPWPQPVPALAPGPPPQDLAAYYYYRPLYDAYQPQYSLPYPPEPGAASLYYQDVYSLYEPRYRPYDGAASAYAQNYRYPEPERPSSRASHSSERPPPRQGYPEGYYSSKSGWSSQSDYYASYYSSQYDYGDPGHWDRYHYSARVRDPRTYDRRYWCDAEYDAYRREHSAFGDRPEKRDNNWRYDPRFTGSFDDDPDPHRDPYGEEVDRRSVHSEHSARSLHSAHSLASRRSSLSSHSHQSQIYRSHNVAAGSYEAPLPPGSFHGDFAYGTYRSNFSSGPGFPEYGYPADTVWPAMEQVSSRPTSPEKFSVPHVCARFGPGGQLIKVIPNLPSEGQPALVEVHSMEALLQHTSEQEEMRAFPGPLAKDDTHKVDVINFAQNKAMKCLQNENLIDKESASLLWNFIVLLCRQNGTVVGTDIAELLLRDHRTVWLPGKSPNEANLIDFTNEAVEQVEEEESGEAQLSFLTGGPAAAASSLERETERFRELLLYGRKKDALESAMKNGLWGHALLLASKMDSRTHARVMTRFANSLPINDPLQTVYQLMSGRMPAASTCCGDEKWGDWRPHLAMVLSNLNNNMDVESRTMATMGDTLASRGLLDAAHFCYLMAQAGFGVYTKKTTKLVLIGSNHSLPFLKFATNEAIQRTEAYEYAQSLGAETCPLPSFQVFKFIYSCRLAEMGLATQAFHYCEAIAKSILTQPHLYSPVLISQLVQMASQLRLFDPQLKEKPEEESLAAPTWLVHLQQVERQIKEGAGVWHQDGALPQQCPGTPSSEMEQLDRPGLSQPGALGIANPLLAVPAPSPEHSSPSVRLLPSAPQTLPDGPLASPARVPMFPVPLPPGPLEPGPGCVTPGPALGFLEPSGPGLPPGVPPLQERRHLLQEARSPDPGIVPQEAPVGNSLSELSEENFDGKFANLTPSRTVPDSEAPPGWDRADSGPTQPPLSLSPAPETKRPGQAAKKETKEPKKGESWFFRWLPGKKKTEAYLPDDKNKSIVWDEKKNQWVNLNEPEEEKKAPPPPPTSMPKTVQAAPPALPGPPGAPVNMYSRRAAGTRARYVDVLNPSGTQRSEPALAPADFVAPLAPLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKVLSSAASLPGSELPSSRPEGSQGGELSRCSSMSSLSREVSQHFNQAPGDLPAAGGPPSGAMPFYNPAQLAQACATSGSSRLGRIGQRKHLVLN EAE9570BD5CD434B lrrk2-sec16a 2 14 unspecified role unspecified role prey prey 10 unspecified role unspecified role bait bait n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association Supp 1A lrrk2-sec16a-1 9 10 unspecified role unspecified role bait bait n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q5S007:p.Arg1441Cys mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R C Wed May 02 15:30:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1441cys' Tue Jun 30 16:49:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1441Cys' Q5S007:p.Lys1347Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 17:01:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1347ala' Tue Jun 30 17:24:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1347Ala' roc_domain sufficient to bind sufficient binding region sufficient to bind range range range range 14 unspecified role unspecified role prey prey physical association physical association 1A/C, 5A, Supp 3A lrrk2-sec16a-2 1 12 unspecified role unspecified role prey prey 13 unspecified role unspecified role bait bait physical association physical association 1B lrrk2-sec16a-3 7 14 unspecified role unspecified role prey prey region_containing_central_conserved_domain required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range 10 unspecified role unspecified role bait bait n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range physical association physical association 1D sec16a-lrrk2-1 5 11 western blot western blot Immuno blot Immuno blot anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 competitor competitor competitor prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 14 unspecified role unspecified role bait bait region_containing_central_conserved_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. association association 1E/F sec16a-lrrk2-2 3 11 unspecified role unspecified role prey prey n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 14 unspecified role unspecified role bait bait region_containing_central_conserved_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. association association 1E-2 lrrk2-sec16a-4 4 14 unspecified role unspecified role neutral component neutral component 10 unspecified role unspecified role neutral component neutral component colocalization colocalization 1G lrrk2-sec16a-5 6 12 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component colocalization colocalization 6 lrrk2-sec16a-6 4 10 unspecified role unspecified role neutral component neutral component 14 tag visualisation tag visualisation immunocytochemistry immunocytochemistry unspecified role unspecified role neutral component neutral component n_terminus gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization Supp 2D lrrk2-sec16a-7 8 10 unspecified role unspecified role neutral component neutral component n_terminus myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range Q5S007:p.Arg1441Cys mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain R C Wed May 02 14:58:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg1441cys' Tue Jun 30 17:51:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg1441Cys' Q5S007:p.Lys1347Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain K A Wed May 02 18:54:53 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys1347ala' Tue Jun 30 15:51:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys1347Ala' 12 unspecified role unspecified role neutral component neutral component colocalization colocalization Supp 3 E, F (boxA), G-L