MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it FrxA is a GSNO reductase enzyme that contributes to Helicobacter pylori pathogenicity. FrxA is a GSNO reductase enzyme that contributes to Helicobacter pylori pathogenicity. FEBS J. (1742-464X) 2014 imex curation Justino M.C., Parente M.R., Boneca I.G., Saraiva L.M. lst@itqb.unl.pt 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined lst@itqb.unl.pt Accepted 2014-AUG-04 by MARTA imex curation q7bgi8_helpx BB397_06830 DD744_03375 DD748_03855 DD749_03405 DD767_02880 DD778_03010 DDP51_03415 HPY499_05790 frxA EC550_05940 ECC20_07225 EC527_03545 C2840_03330 DDP35_03535 C2R45_03525 C2R53_07115 C2R80_05000 C2R82_03790 C2R91_01680 C2S01_06315 C2S02_00170 C2S07_02150 C2S30_05055 C2S42_01405 C2S44_05455 C2S45_01905 CV729_04235 CV730_04105 D8X81_03425 F7198_05755 protein protein helpx Helicobacter pylori Campylobacter pylori MDREQVVALQHQRFAAKKYDPNRRISQKDWEALVEVGRLAPSSIGLEPWKMLLLKNERMKEDLKPMAWGALFGLEGASHFVIYLARKGVTYDSDYVKKVMHEVKKRDYDTNSRFAQIIKNFQENDMKLNSERSLFDWASKQTYIQMANMMMAAAMLGIDSCPIEGYDQEKVEAYLEEKGYLNTAEFGVSVMACFGYRNQEITPKTRWKTEVIYEVIE mint 07330EC11ACB7AA6 frxa-1 1 FrxA 2 unspecified role unspecified role neutral component neutral component his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction F1B