IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ IRF4 is a key thermogenic transcriptional partner of PGC-1α. IRF4 is a key thermogenic transcriptional partner of PGC-1α. Cell (0092-8674) 2014 imex curation Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu Accepted 2014-NOV-24 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation IRF4 is a key thermogenic transcriptional partner of PGC-1α. IRF4 is a key thermogenic transcriptional partner of PGC-1α. Cell (0092-8674) 2014 imex curation Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu Accepted 2014-NOV-24 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation IRF4 is a key thermogenic transcriptional partner of PGC-1α. IRF4 is a key thermogenic transcriptional partner of PGC-1α. Cell (0092-8674) 2014 imex curation Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-brown_adipose Mouse Brown Adipose Tissue brown_adipose Brown Adipose Tissue ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu Accepted 2014-NOV-24 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation IRF4 is a key thermogenic transcriptional partner of PGC-1α. IRF4 is a key thermogenic transcriptional partner of PGC-1α. Cell (0092-8674) 2014 imex curation Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-brown_adipose Mouse Brown Adipose Tissue brown_adipose Brown Adipose Tissue anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu Accepted 2014-NOV-24 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation IRF4 is a key thermogenic transcriptional partner of PGC-1α. IRF4 is a key thermogenic transcriptional partner of PGC-1α. Cell (0092-8674) 2014 imex curation Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu Accepted 2014-NOV-24 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation IRF4 is a key thermogenic transcriptional partner of PGC-1α. IRF4 is a key thermogenic transcriptional partner of PGC-1α. Cell (0092-8674) 2014 imex curation Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Kong X., Banks A., Liu T., Kazak L., Rao R.R., Cohen P., Wang X., Yu S., Lo J.C., Tseng Y.H., Cypess A.M., Xue R., Kleiner S., Kang S., Spiegelman B.M., Rosen E.D. erosen@bidmc.harvard.edu Accepted 2014-NOV-24 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation ucp1_mouse_gene Mitochondrial brown fat uncoupling protein 1 gene gene mouse Mus musculus Mouse irf4_mouse Interferon regulatory factor 4 Irf4 Spip Lymphocyte-specific interferon regulatory factor NF-EM5 PU.1 interaction partner Transcriptional activator PIP protein protein mouse Mus musculus Mouse MNLETGSRGSEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSVFRIPWKHAGKQDYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISDPYKVYRIVPEGAKKGAKQLTLDDTQMAMGHPYPMTAPYGSLPAQQVHNYMMPPHDRSWRDYAPDQSHPEIPYQCPVTFGPRGHHWQGPSCENGCQVTGTFYACAPPESQAPGIPIEPSIRSAEALALSDCRLHICLYYRDILVKELTTTSPEGCRISHGHTYDVSNLDQVLFPYPDDNGQRKNIEKLLSHLERGLVLWMAPDGLYAKRLCQSRIYWDGPLALCSDRPNKLERDQTCKLFDTQQFLSELQVFAHHGRPAPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQNTGHFLRGYELPEHVTTPDYHRSLRHSSIQE DIP protein Q64287 original sequence version: 111 5FD94CA6C453869C prgc1_mouse Peroxisome proliferator-activated receptor gamma coactivator 1-alpha Ppargc1a Pgc1 Pgc1a Ppargc1 protein protein mouse Mus musculus Mouse MAWDMCSQDSVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSDQSEIISNQYNNEPANIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGAVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHAANHTHRIRTNPAIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCASKKKSHTQPQSQHAQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTPPHKANQDNPFKASPKLKPSCKTVVPPPTKRARYSECSGTQGSHSTKKGPEQSELYAQLSKSSGLSRGHEERKTKRPSLRLFGDHDYCQSLNSKTDILINISQELQDSRQLDFKDASCDWQGHICSSTDSGQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPCQAVFDDKSDKTSELRDGDFSNEQFSKLPVFINSGLAMDGLFDDSEDESDKLSYPWDGTQPYSLFDVSPSCSSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSCYYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEAYEHERLKRDEYRKEHEKRESERAKQRERQKQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDTNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR DIP protein O70343 original sequence version: 117 DIP protein O70343-1 original sequence version: 120 DIP protein O70343 original sequence version: 120 DIP protein O70343 original sequence version: 67 AE73EE2B3A622B05 irf4-ppargc1a 2 9 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 8 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection physical association physical association Fig. 7A, Sup. Fig. 7D, 7E ppargc1a-irf4 6 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection physical association physical association Fig. 7A irf4-ppargc1a-1 4 9 unspecified role unspecified role prey prey 8 unspecified role unspecified role bait bait physical association physical association Fig. 7B ppargc1a-irf4-1 4 9 unspecified role unspecified role bait bait 8 unspecified role unspecified role prey prey physical association physical association Fig. 7B ppargc1a-irf4-3 5 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection smad_domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Supp. Fig. 7G ppargc1a-irf4-2 1 9 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection in vitro In vitro physical association physical association 7C irf4-ucp1 3 8 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey promoter region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association Fig. 7E Q64287 increases expression at protein level of ENSMUSG00000031710