IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. Cell (0092-8674) 2014 imex curation Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Supp Figs. 4A/B not annotated as I am not sure what proteins constitute the 'full chaperon system (methodology also a bit of a mystery in Sup Fig 4a). All reactivation of an inhibition data (includes all data relating to Bag1) has not been captured as too complicated. agard@msg.ucsf.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Supp Figs. 4A/B not annotated as I am not sure what proteins constitute the 'full chaperon system (methodology also a bit of a mystery in Sup Fig 4a). All reactivation of an inhibition data (includes all data relating to Bag1) has not been captured as too complicated. Protein identities confirmed by both light scattering and comassie staining in an SDS gel. agard@msg.ucsf.edu Accepted 2014-NOV-13 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. Cell (0092-8674) 2014 imex curation Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Supp Figs. 4A/B not annotated as I am not sure what proteins constitute the 'full chaperon system (methodology also a bit of a mystery in Sup Fig 4a). All reactivation of an inhibition data (includes all data relating to Bag1) has not been captured as too complicated. agard@msg.ucsf.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Supp Figs. 4A/B not annotated as I am not sure what proteins constitute the 'full chaperon system (methodology also a bit of a mystery in Sup Fig 4a). All reactivation of an inhibition data (includes all data relating to Bag1) has not been captured as too complicated. agard@msg.ucsf.edu Accepted 2014-NOV-13 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. Cell (0092-8674) 2014 imex curation Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Supp Figs. 4A/B not annotated as I am not sure what proteins constitute the 'full chaperon system (methodology also a bit of a mystery in Sup Fig 4a). All reactivation of an inhibition data (includes all data relating to Bag1) has not been captured as too complicated. agard@msg.ucsf.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro crosslink cross-linking study crosslink weight by comassie molecular weight estimation by coomasie staining weight by comassie Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Supp Figs. 4A/B not annotated as I am not sure what proteins constitute the 'full chaperon system (methodology also a bit of a mystery in Sup Fig 4a). All reactivation of an inhibition data (includes all data relating to Bag1) has not been captured as too complicated. Protein fractions from a gel filtration column crosslinked with 0.02% glutaraldehyde comassie staining in an SDS gel. agard@msg.ucsf.edu Accepted 2014-NOV-13 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. Cell (0092-8674) 2014 imex curation Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Supp Figs. 4A/B not annotated as I am not sure what proteins constitute the 'full chaperon system (methodology also a bit of a mystery in Sup Fig 4a). All reactivation of an inhibition data (includes all data relating to Bag1) has not been captured as too complicated. agard@msg.ucsf.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro h1-h2 ms mass spectrometry study of hydrogen/deuterium exchange h1-h2 ms ms participant Identification by mass spectrometry ms participant Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Supp Figs. 4A/B not annotated as I am not sure what proteins constitute the 'full chaperon system (methodology also a bit of a mystery in Sup Fig 4a). All reactivation of an inhibition data (includes all data relating to Bag1) has not been captured as too complicated. agard@msg.ucsf.edu Accepted 2014-NOV-13 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. Cell (0092-8674) 2014 imex curation Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Supp Figs. 4A/B not annotated as I am not sure what proteins constitute the 'full chaperon system (methodology also a bit of a mystery in Sup Fig 4a). All reactivation of an inhibition data (includes all data relating to Bag1) has not been captured as too complicated. agard@msg.ucsf.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro electron microscopy electron microscopy Electron crystallography Electron cryomicroscopy Electron crystallography Electron cryomicroscopy predetermined predetermined participant predetermined Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Supp Figs. 4A/B not annotated as I am not sure what proteins constitute the 'full chaperon system (methodology also a bit of a mystery in Sup Fig 4a). All reactivation of an inhibition data (includes all data relating to Bag1) has not been captured as too complicated. Protein identities confirmed by both light scattering and comassie staining in an SDS gel. agard@msg.ucsf.edu Accepted 2014-NOV-13 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. Glucocorticoid receptor function regulated by coordinated action of the Hsp90 and Hsp70 chaperone cycles. Cell (0092-8674) 2014 imex curation Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Supp Figs. 4A/B not annotated as I am not sure what proteins constitute the 'full chaperon system (methodology also a bit of a mystery in Sup Fig 4a). All reactivation of an inhibition data (includes all data relating to Bag1) has not been captured as too complicated. agard@msg.ucsf.edu 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Kirschke E., Goswami D., Southworth D., Griffin P.R., Agard D.A. Supp Figs. 4A/B not annotated as I am not sure what proteins constitute the 'full chaperon system (methodology also a bit of a mystery in Sup Fig 4a). All reactivation of an inhibition data (includes all data relating to Bag1) has not been captured as too complicated. agard@msg.ucsf.edu Accepted 2014-NOV-13 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation stip1_human Stress-induced-phosphoprotein 1 Hsc70/Hsp90-organizing protein STIP1 Transformation-sensitive protein IEF SSP 3521 Renal carcinoma antigen NY-REN-11 protein protein human Homo sapiens Human MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPDWGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRELCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQERLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEECIQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR DIP protein P31948 original sequence version: 121 DIP protein P31948 original sequence version: 126 8E58ECA13825CB0E dexamethasone (8S,9R,10S,11S,13S,14S,16R,17R)-9- Fluoro-11,17-dihydroxy-17-(2-hydroxyacetyl)-10,13,16- trimethyl-6,7,8,9,10,11,12,13,14,15,16,17- dodecahydro-3H-cyclopenta[a]phenanthren-3-one small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) tebp_human Prostaglandin E synthase 3 Cytosolic prostaglandin E2 synthase Telomerase-binding protein p23 Progesterone receptor complex p23 PTGES3 P23 TEBP Hsp90 co-chaperone protein protein human Homo sapiens Human MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE DIP protein Q15185 original sequence version: 98 DIP protein Q15185 original sequence version: 117 23538BB9D7AFD73F hs90a_human Heat shock protein HSP 90-alpha HSP90AA1 HSP90A HSPC1 Heat shock 86 kDa Renal carcinoma antigen NY-REN-38 HSPCA Lipopolysaccharide-associated protein 2 protein protein human Homo sapiens Human MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKEDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPPLEGDDDTSRMEEVD DIP protein P07900 original sequence version: 197 DIP protein P07900 original sequence version: 116 DIP protein P07900 original sequence version: 150 DIP protein P07900-1 original sequence version: 158 DIP protein P07900 original sequence version: 207 DIP protein P07900 original sequence version: 192 DIP protein P07900 original sequence version: 156 969F65FCC0BC86FD gcr_human Glucocorticoid receptor Nuclear receptor subfamily 3 group C member 1 NR3C1 GRL protein protein human Homo sapiens Human MDSKESLTPGREENPSSVLAQERGDVMDFYKTLRGGATVKVSASSPSLAVASQSDSKQRRLLVDFPKGSVSNAQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQISLSSGETDLKLLEESIANLNRSTSVPENPKSSASTAVSAAPTEKEFPKTHSDVSSEQQHLKGQTGTNGGNVKLYTTDQSTFDILQDLEFSSGSPGKETNESPWRSDLLIDENCLLSPLAGEDDSFLLEGNSNEDCKPLILPDTKPKIKDNGDLVLSSPSNVTLPQVKTEKEDFIELCTPGVIKQEKLGTVYCQASFPGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPPIPVGSENWNRCQGSGDDNLTSLGTLNFPGRTVFSNGYSSPSMRPDVSSPPSSSSTATTGPPPKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENPGNKTIVPATLPQLTPTLVSLLEVIEPEVLYAGYDSSVPDSTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLLQYSWMFLMAFALGWRSYRQSSANLLCFAPDLIINEQRMTLPCMYDQCKHMLYVSSELHRLQVSYEEYLCMKTLLLLSSVPKDGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK C5C90C9A5DD16AAB hsp71_human Heat shock 70 kDa protein 1A/1B HSPA1A HSPA1 HSPA1B Heat shock 70 kDa protein 1/2 HSX70 protein protein human Homo sapiens Human MAKAAAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLIGRKFGDPVVQSDMKHWPFQVINDGDKPKVQVSYKGETKAFYPEEISSMVLTKMKEIAEAYLGYPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLVNHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQASLEIDSLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDLVLVGGSTRIPKVQKLLQDFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTFDIDANGILNVTATDKSTGKANKITITNDKGRLSKEEIERMVQEAEKYKAEDEVQRERVSAKNALESYAFNMKSAVEDEGLKGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKRKELEQVCNPIISGLYQGAGGPGPGGFGAQGPKGGSGSGPTIEEVD 78F513118C96DE66 mas5_yeast Mitochondrial protein import protein MAS5 YDJ1 MAS5 YNL064C N2418 YNL2418C Yeast dnaJ protein 1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKFPENHFTSEENLKKLEEILPPRIVPAIPKKATVDECVLADFDPAKYNRTRASRGGANYDSDEEEQGGEGVQCASQ E4539F3618DD9CF2 E4539F3618DD9CF2 dexamethasone-nr3c1-2 6 11 unspecified role unspecified role neutral component neutral component lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain F S Wed May 02 20:14:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe602ser' Tue Jun 30 19:17:54 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe602Ser' n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Fig. 1, 4C Supp. Fig. 1 No enhancement in ligand binding by Hsp90 was detected. dexamethasone-nr3c1-3 6 11 unspecified role unspecified role neutral component neutral component n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction Supp. Fig. 1 dexamethasone-hspa1a 6 11 unspecified role unspecified role neutral component neutral component P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain F S Wed May 02 15:31:48 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe602ser' Tue Jun 30 16:26:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe602Ser' lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 12 inhibitor inhibitor neutral component neutral component ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component region fluorescein fluorescein label fluorescein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 inhibitor inhibitor neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig. 2A, 2C, 4C-H, Supp. Fig. 1C, 1E Inhibition of dexamethsone binding is ATP dependant. Significant recovery from inhbition by Hsp40/70 occurred with Hsp90 (P07900 ) and either STIP1/Hop (P31948) or PTGES3 (Q15185). This recovery is inhibited by the HSP90 inhibitor 17AAG. The Hsp90 concentration dependence of recovery saturates at stoichiometric amounts of Hsp90 dimer and GR and mutant studies indicate that both nucleotide binding and hydrolysis are required to reverse Hsp70 inhibition. The concentration dependence of Hsp70 shows a cooperative mode of inhibition with a half-maximal inhibitory concentration (IC50) of 4.6 +/- 0.6 μM and a Hill coefficient of 1.6 +/- 0.6. The F602S mutation had no effect on the IC50. I have not tried to capture the recovery from inhibition, except as a comment. nr3c1-hspa1a 2 11 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain F S Wed May 02 16:39:22 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe602ser' Tue Jun 30 20:12:43 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe602Ser' lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) association association Supp. Fig. 1D, Supp Fig. 3 Bag1 nr3c1-hspa1a-1 4 11 unspecified role unspecified role neutral component neutral component n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain F S Wed May 02 20:29:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe602ser' Tue Jun 30 18:10:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe602Ser' ecoli Escherichia coli (strain K12) 13 western blot western blot Immuno blot Immuno blot ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig 3. Supp. Fig. 2C nr3c1-hsp90aa1 2 11 unspecified role unspecified role bait bait n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain F S Wed May 02 15:13:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe602ser' Tue Jun 30 20:00:33 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe602Ser' lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 13 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) association association Supp Fig. 3 nr3c1-hsp90aa1-1 2 11 unspecified role unspecified role bait bait P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain F S Wed May 02 16:00:46 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe602ser' Tue Jun 30 17:44:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe602Ser' lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 13 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 9 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) association association Supp Fig. 3 17AAG (a specific Hsp90 inhibitor), HSP90 Glu47Ala and Asp93Asn mutants caused a significant loss in PTGES3 binding to the GR complex. nr3c1-hsp90aa1-2 2 11 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain F S Wed May 02 18:22:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe602ser' Tue Jun 30 15:41:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe602Ser' n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 7 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 13 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) 9 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) association association Supp Fig. 3 hsp90aa1-hspa1a 1 7 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Supp Fig. 5A-B hsp90aa1-hspa1a-1 1 11 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain F S Wed May 02 19:44:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe602ser' Tue Jun 30 19:55:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe602Ser' lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 7 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Supp Fig. 5A-C hsp90aa1-hspa1a-2 5 11 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain F S Wed May 02 19:32:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe602ser' Tue Jun 30 19:23:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe602Ser' n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 7 western blot western blot Immuno blot Immuno blot predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Fig. 5, Supp Fig. 5D, 5E, 6 38A hsp90aa1-hspa1a-2 3 10 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 7 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection physical association physical association Supp Fig. 5A-B hsp90aa1-hspa1a-2 3 11 unspecified role unspecified role neutral component neutral component lbd region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P04150:p.Phe602Ser mutation mutation certain certain sequence position certain certain certain sequence position certain F S Wed May 02 19:26:40 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe602ser' Tue Jun 30 19:19:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe602Ser' n-terminal mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 10 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined spofr-sf_9 Spodoptera frugiperda insect cells Fall armyworm sf_9 insect cells Derived from pupal ovarian tissue of the fall armyworm Cloned from the parent cell line, IPLB-SF-21-AE (SF-21) derived from immature ovaries of fall armyworm Spodoptera frugiperda pupae cells are susceptible to Baculovirus infection 7 western blot western blot Immuno blot Immuno blot weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Supp Fig. 5A-C