MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Modulation of CD6 function through interaction with Galectin-1 and -3. Modulation of CD6 function through interaction with Galectin-1 and -3. FEBS Lett. (0014-5793) 2014 imex curation Escoda-Ferran C., Carrasco E., Caballero-Baños M., Miró-Julià C., Martínez-Florensa M., Consuegra-Fernández M., Martínez V.G., Liu F.T., Lozano F. flozano@clinic.ub.es 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro competition binding competition binding tag visualisation tag visualisation flozano@clinic.ub.es Accepted 2014-MAY-23 by LUANA 2014 imex curation Modulation of CD6 function through interaction with Galectin-1 and -3. Modulation of CD6 function through interaction with Galectin-1 and -3. FEBS Lett. (0014-5793) 2014 imex curation Escoda-Ferran C., Carrasco E., Caballero-Baños M., Miró-Julià C., Martínez-Florensa M., Consuegra-Fernández M., Martínez V.G., Liu F.T., Lozano F. flozano@clinic.ub.es 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa antibody detection identification by antibody antibody detection flozano@clinic.ub.es Accepted 2014-MAY-23 by LUANA 2014 imex curation Modulation of CD6 function through interaction with Galectin-1 and -3. Modulation of CD6 function through interaction with Galectin-1 and -3. FEBS Lett. (0014-5793) 2014 imex curation Escoda-Ferran C., Carrasco E., Caballero-Baños M., Miró-Julià C., Martínez-Florensa M., Consuegra-Fernández M., Martínez V.G., Liu F.T., Lozano F. flozano@clinic.ub.es 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro elisa enzyme linked immunosorbent assay ELISA ELISA elisa tag visualisation tag visualisation flozano@clinic.ub.es Accepted 2014-MAY-23 by LUANA 2014 imex curation Modulation of CD6 function through interaction with Galectin-1 and -3. Modulation of CD6 function through interaction with Galectin-1 and -3. FEBS Lett. (0014-5793) 2014 imex curation Escoda-Ferran C., Carrasco E., Caballero-Baños M., Miró-Julià C., Martínez-Florensa M., Consuegra-Fernández M., Martínez V.G., Liu F.T., Lozano F. flozano@clinic.ub.es 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot flozano@clinic.ub.es Accepted 2014-MAY-23 by LUANA 2014 imex curation cd6_human T-cell differentiation antigen CD6 CD6 T12 TP120 protein protein human Homo sapiens Human MWLFFGITGLLTAALSGHPSPAPPDQLNTSSAESELWEPGERLPVRLTNGSSSCSGTVEVRLEASWEPACGALWDSRAAEAVCRALGCGGAEAASQLAPPTPELPPPPAAGNTSVAANATLAGAPALLCSGAEWRLCEVVEHACRSDGRRARVTCAENRALRLVDGGGACAGRVEMLEHGEWGSVCDDTWDLEDAHVVCRQLGCGWAVQALPGLHFTPGRGPIHRDQVNCSGAEAYLWDCPGLPGQHYCGHKEDAGAVCSEHQSWRLTGGADRCEGQVEVHFRGVWNTVCDSEWYPSEAKVLCQSLGCGTAVERPKGLPHSLSGRMYYSCNGEELTLSNCSWRFNNSNLCSQSLAARVLCSASRSLHNLSTPEVPASVQTVTIESSVTVKIENKESRELMLLIPSIVLGILLLGSLIFIAFILLRIKGKYALPVMVNHQHLPTTIPAGSNSYQPVPITIPKEVFMLPIQVQAPPPEDSDSGSDSDYEHYDFSAQPPVALTTFYNSQRHRVTDEEVQQSRFQMPPLEEGLEELHASHIPTANPGHCITDPPSLGPQYHPRSNSESSTSSGEDYCNSPKSKLPPWNPQVFSSERSSFLEQPPNLELAGTQPAFSAGPPADDSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDNDDYDDISAA DIP protein P30203 original sequence version: 131 59E6790E77FFBC42 leg3_human Galectin-3 LGALS3 MAC2 Galactose-specific lectin 3 Mac-2 antigen IgE-binding protein 35 kDa lectin Carbohydrate-binding protein 35 Laminin-binding protein Lectin L-29 L-31 Galactoside-binding protein protein protein human Homo sapiens Human MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI DIP protein P17931 original sequence version: 132 DIP protein P17931 original sequence version: 181 C49DDF6D67AE0C88 cd166_human CD166 antigen Activated leukocyte cell adhesion molecule ALCAM MEMD protein protein human Homo sapiens Human MESKGASSCRLLFCLLISATVFRPGLGWYTVNSAYGDTIIIPCRLDVPQNLMFGKWKYEKPDGSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYTLSISNARISDEKRFVCMLVTEDNVFEAPTIVKVFKQPSKPEIVSKALFLETEQLKKLGDCISEDSYPDGNITWYRNGKVLHPLEGAVVIIFKKEMDPVTQLYTMTSTLEYKTTKADIQMPFTCSVTYYGPSGQKTIHSEQAVFDIYYPTEQVTIQVLPPKNAIKEGDNITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTLTDVRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTRQIGDALPVSCTISASRNATVVWMKDNIRLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKMTKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEENVTLTCTAENQLERTVNSLNVSAISIPEHDEADEISDENREKVNDQAKLIVGIVVGLLLAALVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA DIP protein Q13740 original sequence version: 149 68FEFD67C14B0C57 leg1_human Galectin-1 Lectin galactoside-binding soluble 1 Beta-galactoside-binding lectin L-14-I S-Lac lectin 1 Galaptin 14 kDa lectin HPL HBL Putative MAPK-activating protein PM12 LGALS1 Lactose-binding lectin 1 14 kDa laminin-binding protein protein protein human Homo sapiens Human MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD DIP protein P09382 original sequence version: null DIP protein P09382 original sequence version: 111 2FBB8D7A1FC0F1F9 cd6-lgals1 3 CD6 5 tag visualisation tag visualisation tag visualisation tag visualisation unspecified role unspecified role prey prey purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Gal-1 8 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1b lgals1-cd6 3 Gal-3 6 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P17931:p.Arg186Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R S Wed May 02 19:37:36 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg186ser' Tue Jun 30 20:09:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg186Ser' CD6 5 tag visualisation tag visualisation tag visualisation tag visualisation unspecified role unspecified role prey prey purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1c f1g lgals1-cd6-1 4 CD6 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Gal-1 8 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1e lgals3-cd6 4 Gal-3 6 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CD6 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified biotin tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1f cd6-lgals1-1 1 ALCAM 7 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined CD6 5 tag visualisation tag visualisation tag visualisation tag visualisation unspecified role unspecified role prey prey purified purified bioting tag biotin tag biotin tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Gal1 8 predetermined predetermined participant predetermined tag visualisation tag visualisation competitor competitor competitor prey prey purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f2d alcam-lgals1 3 Gal1 8 tag visualisation tag visualisation tag visualisation tag visualisation unspecified role unspecified role prey prey purified purified biotin/gst tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ALCAM 7 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f3a alcam-lgals1-1 3 ALCAM 7 predetermined predetermined participant predetermined tag visualisation tag visualisation unspecified role unspecified role bait bait purified purified tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Gal3 6 tag visualisation tag visualisation tag visualisation tag visualisation unspecified role unspecified role prey prey purified purified biotin/gst tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f3a alcam-lgals1-2 4 ALCAM 7 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Gal1 8 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f3b lgals1-alcam 4 Gal3 6 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ALCAM 7 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey purified purified tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f3c alcam-cd6 2 CD6 5 predetermined predetermined participant predetermined antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait purified purified ALCAM 7 antibody detection identification by antibody antibody detection antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey purified purified tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f3d cd6-alcam 2 Gal3 6 predetermined predetermined participant predetermined antibody detection identification by antibody antibody detection unspecified role unspecified role bait bait purified purified P17931:p.Arg186Ser mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R S Wed May 02 15:18:14 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg186ser' Tue Jun 30 15:36:30 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg186Ser' ALCAM 7 antibody detection identification by antibody antibody detection antibody detection identification by antibody antibody detection unspecified role unspecified role prey prey purified purified tag fc-igg tag fc-igg tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f3d