IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The rhino-deadlock-cutoff complex licenses noncanonical transcription of dual-strand piRNA clusters in Drosophila. The rhino-deadlock-cutoff complex licenses noncanonical transcription of dual-strand piRNA clusters in Drosophila. Cell (0092-8674) 2014 imex curation Mohn F., Sienski G., Handler D., Brennecke J. fabio.mohn@imba.oeaw.ac.at, julius.brennecke@imba.oeaw.ac.at 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Mohn F., Sienski G., Handler D., Brennecke J. fabio.mohn@imba.oeaw.ac.at, julius.brennecke@imba.oeaw.ac.at Accepted 2015-JUL-10 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation The rhino-deadlock-cutoff complex licenses noncanonical transcription of dual-strand piRNA clusters in Drosophila. The rhino-deadlock-cutoff complex licenses noncanonical transcription of dual-strand piRNA clusters in Drosophila. Cell (0092-8674) 2014 imex curation Mohn F., Sienski G., Handler D., Brennecke J. fabio.mohn@imba.oeaw.ac.at, julius.brennecke@imba.oeaw.ac.at 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions drome-nurse_cell Drosophila melanogaster nurse_cell Nurse cell confocal microscopy confocal microscopy immunostaining immunostaining Mohn F., Sienski G., Handler D., Brennecke J. fabio.mohn@imba.oeaw.ac.at, julius.brennecke@imba.oeaw.ac.at Accepted 2015-JUL-10 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation The rhino-deadlock-cutoff complex licenses noncanonical transcription of dual-strand piRNA clusters in Drosophila. The rhino-deadlock-cutoff complex licenses noncanonical transcription of dual-strand piRNA clusters in Drosophila. Cell (0092-8674) 2014 imex curation Mohn F., Sienski G., Handler D., Brennecke J. fabio.mohn@imba.oeaw.ac.at, julius.brennecke@imba.oeaw.ac.at 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Mohn F., Sienski G., Handler D., Brennecke J. fabio.mohn@imba.oeaw.ac.at, julius.brennecke@imba.oeaw.ac.at Accepted 2015-JUL-10 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation The rhino-deadlock-cutoff complex licenses noncanonical transcription of dual-strand piRNA clusters in Drosophila. The rhino-deadlock-cutoff complex licenses noncanonical transcription of dual-strand piRNA clusters in Drosophila. Cell (0092-8674) 2014 imex curation Mohn F., Sienski G., Handler D., Brennecke J. fabio.mohn@imba.oeaw.ac.at, julius.brennecke@imba.oeaw.ac.at 17-Sep-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay antibody detection identification by antibody antibody detection Mohn F., Sienski G., Handler D., Brennecke J. Author has ignored h-27 methylation so I have too. Its very weak. fabio.mohn@imba.oeaw.ac.at, julius.brennecke@imba.oeaw.ac.at Accepted 2015-JUL-10 by PPORRAS Cell (0092-8674) 2014 Only protein-protein interactions imex curation q7jxa8_drome rhi rhino hp1d Dmel\CG10683 HP1 HP1D HP1d RHI Rhi Rhino rno CG10683 Dmel_CG10683 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MSRNHQRPNLGLVDAPPNDHVEEYVVEKILGKRFVNGRPQVLVKWSGFPNENNTWEPLENVGNCMKLVSDFESEVFRLHRKAAAKSVGKSKSSPSSSGPLITENGPSSSKKTQQHSKSVQAKNTAGMSKMNQKKGKNIKKTAGKIKDIENYPKTQMPSTSQVSTDSTEVFDGNPSATTTNMIKSPRIQSLFSDLNLIEPTKDKDVGDTSLKTPPKSRRLIEFPQREDAPLSSKHVSPMLIRKESQPLQSSCTDDSDLGESSSSMSLPTVSSTSSEKSIKVTKSEPKTLGQIKFSSRSSDGGHAASSLGAPKEGDIGLDLSGSDSMDSEVESMRRCPRRKRKKTYPDWKFPEMTKPFGVNRGLDLDKILHCYQMNDDLFMFVTWKGCSSIDAVHINDIKEAYPLQIIKYFESLRIIVPK 8996711F329D4B45 cuff_drome Protein cutoff CG13190 cuff protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MNSNYTILNIRAHSWAEKDNLVFPTITKPVSNGWFAWSPIGQFEPNSQKVPYVVVPPSIKFPISLRYKDSPPKLEKKPNIFLDNMLQYIESSSYMYVMVRNNQQAQLNANIVCTSEVLELMMCAPYEKKTGWSLGVTRYRNTMYICRIDVEQPDPIDQDNLKRAMQEFWLRNLRTHCVFENGIKMHQHNQSSEEHLRFHGVFSFDLNGNRVLFDSPVLAEMPSTTLNGSALSWVDLQIRPMFMSRLDWPEHNRTEALKWWVKCFLLGIESLYIARRDENAHVHNIEKTLVRDLWKSCEKDWSPTVCANFMIYLLNCISQVMAPIDCPSTVYLFQFDASQGTVSYKGLRGRNQYTFVSDWFRMMLDDHTNDMCKTPNLQTMSSIV 0FF9AC48BCCB1AEC del_drome Protein deadlock del CG9252 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MEKLDKIRMSQKLSCWQHILTTLGTSSKTEQEWNTFFKGFLESWRKPYCIQTSCDPSIPLRKELLVRPRKALQENPHGPGSTLPESPVFLEPINSTAPREHPSPSKSHSTGSTGCDPGNGERSPSVSNKNSKYKNPGNSKYAKIWKRSNNHTTSIFSKAQISKRRDKLSSTKKRPDTCAPTDDSRKNREPRACAPNKNIFKTRETNAPNLTKNSCALPNVLILSPNSASKITQRGHSVGQTQDYKASPGKIIKRVPRYSLQCLKKKTEKVHNKIMDKPKNKQQPQTPPPFLLNNEYTESSDDSDDQLPLSELSQKMKSNKLNTLFLSRNEDCSPAPEKVKLKGERPAQNKKEQLTWEPSILTNLTDLGKQVAEPLRKSVKKSAKQQKPRVRAPPQGKKTLPQLQTGLKTQDKQSTHEMISEQAKTISEASGQQTSQVQSSLSPNNIRNNSVKLISAKTLMPAQRSQDYSPNKMQVGQPLGFAIELPSPVDGKEASVEIDTQLVHTSKFLENMTRPSTVEVHKFDLMDIFMGENEKLDYEYDDDDVLSVAASWNGLDDENVPEDEPRKEAKTAEQLPKPEPSTETLKPIEKENAQKMQSIKSFQIPKLNAKNLKTQPSVMRSIYENEELEKNKVLAKPAPPSLVHQPLAESNRNQRDEATAARRAKETFPVFAPLYRVAPESAATLVSANSQQVIPQVYFSTSNQDGVNWIKDVFGIRCMQSVDNKCISINCDHTMNSLGEVQKRLMRMDEDTLLSLYRQTIRSFFLFQTYYTSFVDIFKFRNLWQYLLIMLVDCRLYKSISAPLLAHVYEALSKCGMQKEAVKRIMEHVWLPCKAHKYRDLMLTTLNILSNANWEDYCDKLTQLDKDYNFEIPHKNLITILKSSVDCSDKFANALKLITLHPNSIRTNETIMSILSNASKSYSYMHNESASASQGPPGAASFLAPPAAIQPPHTTVPNFGYLPNPSFHYSNEYAINIHNFD 9A825881240BDC1B h3_drome Histone H3 His3 His3:CG31613 His3:CG33857 His3:CG33860 His3:CG33863 His3:CG33866 CG31613 CG33803 CG33806 CG33809 CG33812 CG33815 CG33818 CG33821 CG33824 CG33827 CG33830 CG33833 CG33836 CG33839 CG33842 CG33845 CG33848 CG33851 CG33854 CG33857 CG33860 CG33863 CG33866 His3:CG33803 His3:CG33806 His3:CG33809 His3:CG33812 His3:CG33815 His3:CG33818 His3:CG33821 His3:CG33824 His3:CG33827 His3:CG33830 His3:CG33833 His3:CG33836 His3:CG33839 His3:CG33842 His3:CG33845 His3:CG33848 His3:CG33851 His3:CG33854 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA DIP protein P02299 original sequence version: 100 6FD8508EA50A0EEC hp1_drome Heterochromatin protein 1 Su(var)205 HP1 CG8409 Non-histone chromosomal protein C1A9 antigen protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MGKKIDNPESSAKVSDAEEEEEEYAVEKIIDRRVRKGKVEYYLKWKGYPETENTWEPENNLDCQDLIQQYEASRKDEEKSAASKKDRPSSSAKAKETQGRASSSTSTASKRKSEEPTAPSGNKSKRTTDAEQDTIPVSGSTGFDRGLEAEKILGASDNNGRLTFLIQFKGVDQAEMVPSSVANEKIPRMVIHFYEERLSWYSDNED DIP protein P05205 original sequence version: 93 DIP protein P05205 original sequence version: 157 DIP protein P05205 original sequence version: 117 6A5B204C487526B7 his3-su_var_205-5 3 8 unspecified role unspecified role bait bait region biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain lys-10 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chromo domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 17 13 direct interaction direct interaction Fig3A, Supp. Fig. 3A his3-su_var_205-6 3 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain lys-10 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role prey prey chromo domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 20 24 direct interaction direct interaction Fig 3A, Supp. Fig. 3A his3-su_var_205-7 4 9 unspecified role unspecified role prey prey chromo domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait region biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range lys-10 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 33 28 direct interaction direct interaction Supp. Fig. 3B his3-su_rhi-1 4 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain lys-10 n6me3+lys N6,N6,N6-trimethyl-L-lysine (5S)-5-amino-5-carboxy-N,N,N-trimethylpentan-1-aminium 2-amino-6-(trimethylammonio)hexanoic acid 5-azanyl-5-carboxy-N,N,N-trimethylpentanazanium MOD_RES N6,N6,N6-trimethyllysine N(zeta)-trimethyllysine N6,N6,N6-trimethyl-L-lysine N6,N6,N6-trimethylated L-lysine N6,N6,N6-trimethyllysin-N6-ium N6,N6,N6-trimethyllysine cation epsilon-trimethyllysine N-trimethylation (of lysine) N6Me3+Lys Trimethyl tri-Methylation certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) 5 unspecified role unspecified role prey prey chromo domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 3A, Supp. Fig. 3A his3-su_var_205-8 4 9 unspecified role unspecified role prey prey chromo domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait lys-10 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. Fig. 3B his3-rhi-2 4 5 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chromo domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait lys-10 n6me1lys N6-methyl-L-lysine (2S)-2-amino-6-methylaminohexanoic acid MOD_RES N6-methyllysine N(zeta)-methyllysine N6-methyl-L-lysine N6-methylated L-lysine epsilon-methyllysine Methyl Methylation N-methyl Lysyl N6Me1Lys certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. Fig. 3B his3-rhi-1 4 5 unspecified role unspecified role prey prey region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chromo domain sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain region biotin tag biotin tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range lys-10 n6me2lys N6,N6-dimethyl-L-lysine (2S)-2-amino-6-(dimethylamino)hexanoic acid MOD_RES N6,N6-dimethyllysine N(zeta)-dimethyllysine N6,N6-dimethyl-L-lysine N6,N6-dimethylated L-lysine epsilon-dimethyllysine lysine derivative Lys(y) Dimethyl N6Me2Lys di-Methylation dimethylk certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. Fig. 3B del-rhi 1 5 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain 70 68 physical association physical association Fig. 4G, Supp. Fig. 4F del-cuff 1 6 unspecified role unspecified role prey prey 7 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain physical association physical association Fig. 4G, Supp. Fig. 4F cuff-del 1 7 unspecified role unspecified role prey prey 6 unspecified role unspecified role bait bait physical association physical association Fig. 4G rhi-del 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait physical association physical association Fig. 4G del-rhi-1 2 5 unspecified role unspecified role neutral component neutral component 7 tag fluorescence tag visualisation by fluorescence tag fluorescence immunostaining immunostaining unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 4A cuff-del-1 2 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 4A cuff-rhi-2 2 6 unspecified role unspecified role neutral component neutral component region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role neutral component neutral component colocalization colocalization Fig. 4A