IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The chaperone-like protein 14-3-3η interacts with human α-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing α-synuclein cellular toxicity. The chaperone-like protein 14-3-3η interacts with human α-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing α-synuclein cellular toxicity. Hum. Mol. Genet. (0964-6906) 2014 imex curation Plotegher N., Kumar D., Tessari I., Brucale M., Munari F., Tosatto L., Belluzzi E., Greggio E., Bisaglia M., Capaldi S., Aioanei D., Mammi S., Monaco H.L., Samorì B., Bubacco L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I have NOT added results from Supp fig 4 (SDS_PAGE) -text states:- ".....show that the amount of soluble aS is lower at the end of the reaction" - you may disagree - but I can see very little evidence for this - both bands look much the same, or not significantly different to me, and NO measurements are given... Experiments containing 14-3-3 theta and gamma isoforms have not been included as the origins of the proteins cannot be determined from the publication, and the author has not replied to a request for information. Similarly interactions involving the pEBG 14-3-3- plasmid used for 293T cell transfections, have not been included (Figure 6). luigi.bubacco@unipd.it 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps predetermined predetermined participant predetermined Plotegher N., Kumar D., Tessari I., Brucale M., Munari F., Tosatto L., Belluzzi E., Greggio E., Bisaglia M., Capaldi S., Aioanei D., Mammi S., Monaco H.L., Samorì B., Bubacco L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. I have NOT added results from Supp fig 4 (SDS_PAGE) -text states:- ".....show that the amount of soluble aS is lower at the end of the reaction" - you may disagree - but I can see very little evidence for this - both bands look much the same, or not significantly different to me, and NO measurements are given... Experiments containing 14-3-3 theta and gamma isoforms have not been included as the origins of the proteins cannot be determined from the publication, and the author has not replied to a request for information. Similarly interactions involving the pEBG 14-3-3- plasmid used for 293T cell transfections, have not been included (Figure 6). luigi.bubacco@unipd.it Accepted 2014-NOV-24 by ORCHARD Hum. Mol. Genet. (0964-6906) 2014 Only protein-protein interactions imex curation The chaperone-like protein 14-3-3η interacts with human α-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing α-synuclein cellular toxicity. The chaperone-like protein 14-3-3η interacts with human α-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing α-synuclein cellular toxicity. Hum. Mol. Genet. (0964-6906) 2014 imex curation Plotegher N., Kumar D., Tessari I., Brucale M., Munari F., Tosatto L., Belluzzi E., Greggio E., Bisaglia M., Capaldi S., Aioanei D., Mammi S., Monaco H.L., Samorì B., Bubacco L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I have NOT added results from Supp fig 4 (SDS_PAGE) -text states:- ".....show that the amount of soluble aS is lower at the end of the reaction" - you may disagree - but I can see very little evidence for this - both bands look much the same, or not significantly different to me, and NO measurements are given... Experiments containing 14-3-3 theta and gamma isoforms have not been included as the origins of the proteins cannot be determined from the publication, and the author has not replied to a request for information. Similarly interactions involving the pEBG 14-3-3- plasmid used for 293T cell transfections, have not been included (Figure 6). luigi.bubacco@unipd.it 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fps fluorescence polarization spectroscopy Fluorescence anisotropy FPS FPS Fluorescence anisotropy fps tag fluorescence tag visualisation by fluorescence tag fluorescence Plotegher N., Kumar D., Tessari I., Brucale M., Munari F., Tosatto L., Belluzzi E., Greggio E., Bisaglia M., Capaldi S., Aioanei D., Mammi S., Monaco H.L., Samorì B., Bubacco L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. I have NOT added results from Supp fig 4 (SDS_PAGE) -text states:- ".....show that the amount of soluble aS is lower at the end of the reaction" - you may disagree - but I can see very little evidence for this - both bands look much the same, or not significantly different to me, and NO measurements are given... Experiments containing 14-3-3 theta and gamma isoforms have not been included as the origins of the proteins cannot be determined from the publication, and the author has not replied to a request for information. Similarly interactions involving the pEBG 14-3-3- plasmid used for 293T cell transfections, have not been included (Figure 6). luigi.bubacco@unipd.it Accepted 2014-NOV-24 by ORCHARD Hum. Mol. Genet. (0964-6906) 2014 Only protein-protein interactions imex curation The chaperone-like protein 14-3-3η interacts with human α-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing α-synuclein cellular toxicity. The chaperone-like protein 14-3-3η interacts with human α-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing α-synuclein cellular toxicity. Hum. Mol. Genet. (0964-6906) 2014 imex curation Plotegher N., Kumar D., Tessari I., Brucale M., Munari F., Tosatto L., Belluzzi E., Greggio E., Bisaglia M., Capaldi S., Aioanei D., Mammi S., Monaco H.L., Samorì B., Bubacco L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I have NOT added results from Supp fig 4 (SDS_PAGE) -text states:- ".....show that the amount of soluble aS is lower at the end of the reaction" - you may disagree - but I can see very little evidence for this - both bands look much the same, or not significantly different to me, and NO measurements are given... Experiments containing 14-3-3 theta and gamma isoforms have not been included as the origins of the proteins cannot be determined from the publication, and the author has not replied to a request for information. Similarly interactions involving the pEBG 14-3-3- plasmid used for 293T cell transfections, have not been included (Figure 6). luigi.bubacco@unipd.it 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro electrophoresis electrophoretic mobility-based method electrophoresis predetermined predetermined participant predetermined Plotegher N., Kumar D., Tessari I., Brucale M., Munari F., Tosatto L., Belluzzi E., Greggio E., Bisaglia M., Capaldi S., Aioanei D., Mammi S., Monaco H.L., Samorì B., Bubacco L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. I have NOT added results from Supp fig 4 (SDS_PAGE) -text states:- ".....show that the amount of soluble aS is lower at the end of the reaction" - you may disagree - but I can see very little evidence for this - both bands look much the same, or not significantly different to me, and NO measurements are given... Experiments containing 14-3-3 theta and gamma isoforms have not been included as the origins of the proteins cannot be determined from the publication, and the author has not replied to a request for information. Similarly interactions involving the pEBG 14-3-3- plasmid used for 293T cell transfections, have not been included (Figure 6). luigi.bubacco@unipd.it Accepted 2014-NOV-24 by ORCHARD Hum. Mol. Genet. (0964-6906) 2014 Only protein-protein interactions imex curation The chaperone-like protein 14-3-3η interacts with human α-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing α-synuclein cellular toxicity. The chaperone-like protein 14-3-3η interacts with human α-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing α-synuclein cellular toxicity. Hum. Mol. Genet. (0964-6906) 2014 imex curation Plotegher N., Kumar D., Tessari I., Brucale M., Munari F., Tosatto L., Belluzzi E., Greggio E., Bisaglia M., Capaldi S., Aioanei D., Mammi S., Monaco H.L., Samorì B., Bubacco L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I have NOT added results from Supp fig 4 (SDS_PAGE) -text states:- ".....show that the amount of soluble aS is lower at the end of the reaction" - you may disagree - but I can see very little evidence for this - both bands look much the same, or not significantly different to me, and NO measurements are given... Experiments containing 14-3-3 theta and gamma isoforms have not been included as the origins of the proteins cannot be determined from the publication, and the author has not replied to a request for information. Similarly interactions involving the pEBG 14-3-3- plasmid used for 293T cell transfections, have not been included (Figure 6). luigi.bubacco@unipd.it 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Plotegher N., Kumar D., Tessari I., Brucale M., Munari F., Tosatto L., Belluzzi E., Greggio E., Bisaglia M., Capaldi S., Aioanei D., Mammi S., Monaco H.L., Samorì B., Bubacco L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. I have NOT added results from Supp fig 4 (SDS_PAGE) -text states:- ".....show that the amount of soluble aS is lower at the end of the reaction" - you may disagree - but I can see very little evidence for this - both bands look much the same, or not significantly different to me, and NO measurements are given... In figure 4 grids were pre-incubated with a 14-3-3-eta antibody, and after sample application a gold-coupled secondary antibody against rabbit IgG was used to locate 14-3-3-eta. Figure 2 used uranyl acetate solution for negative staining on a plain carbon/copper grid. Experiments containing 14-3-3 theta and gamma isoforms have not been included as the origins of the proteins cannot be determined from the publication, and the author has not replied to a request for information. Similarly interactions involving the pEBG 14-3-3- plasmid used for 293T cell transfections, have not been included (Figure 6). luigi.bubacco@unipd.it Accepted 2014-NOV-24 by ORCHARD Hum. Mol. Genet. (0964-6906) 2014 Only protein-protein interactions imex curation The chaperone-like protein 14-3-3η interacts with human α-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing α-synuclein cellular toxicity. The chaperone-like protein 14-3-3η interacts with human α-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing α-synuclein cellular toxicity. Hum. Mol. Genet. (0964-6906) 2014 imex curation Plotegher N., Kumar D., Tessari I., Brucale M., Munari F., Tosatto L., Belluzzi E., Greggio E., Bisaglia M., Capaldi S., Aioanei D., Mammi S., Monaco H.L., Samorì B., Bubacco L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I have NOT added results from Supp fig 4 (SDS_PAGE) -text states:- ".....show that the amount of soluble aS is lower at the end of the reaction" - you may disagree - but I can see very little evidence for this - both bands look much the same, or not significantly different to me, and NO measurements are given... Experiments containing 14-3-3 theta and gamma isoforms have not been included as the origins of the proteins cannot be determined from the publication, and the author has not replied to a request for information. Similarly interactions involving the pEBG 14-3-3- plasmid used for 293T cell transfections, have not been included (Figure 6). luigi.bubacco@unipd.it 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Plotegher N., Kumar D., Tessari I., Brucale M., Munari F., Tosatto L., Belluzzi E., Greggio E., Bisaglia M., Capaldi S., Aioanei D., Mammi S., Monaco H.L., Samorì B., Bubacco L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. I have NOT added results from Supp fig 4 (SDS_PAGE) -text states:- ".....show that the amount of soluble aS is lower at the end of the reaction" - you may disagree - but I can see very little evidence for this - both bands look much the same, or not significantly different to me, and NO measurements are given... Experiments containing 14-3-3 theta and gamma isoforms have not been included as the origins of the proteins cannot be determined from the publication, and the author has not replied to a request for information. Similarly interactions involving the pEBG 14-3-3- plasmid used for 293T cell transfections, have not been included (Figure 6). luigi.bubacco@unipd.it Accepted 2014-NOV-24 by ORCHARD Hum. Mol. Genet. (0964-6906) 2014 Only protein-protein interactions imex curation The chaperone-like protein 14-3-3η interacts with human α-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing α-synuclein cellular toxicity. The chaperone-like protein 14-3-3η interacts with human α-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing α-synuclein cellular toxicity. Hum. Mol. Genet. (0964-6906) 2014 imex curation Plotegher N., Kumar D., Tessari I., Brucale M., Munari F., Tosatto L., Belluzzi E., Greggio E., Bisaglia M., Capaldi S., Aioanei D., Mammi S., Monaco H.L., Samorì B., Bubacco L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I have NOT added results from Supp fig 4 (SDS_PAGE) -text states:- ".....show that the amount of soluble aS is lower at the end of the reaction" - you may disagree - but I can see very little evidence for this - both bands look much the same, or not significantly different to me, and NO measurements are given... Experiments containing 14-3-3 theta and gamma isoforms have not been included as the origins of the proteins cannot be determined from the publication, and the author has not replied to a request for information. Similarly interactions involving the pEBG 14-3-3- plasmid used for 293T cell transfections, have not been included (Figure 6). luigi.bubacco@unipd.it 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro atomic force microsc atomic force microscopy AFM AFM atomic force microsc predetermined predetermined participant predetermined Plotegher N., Kumar D., Tessari I., Brucale M., Munari F., Tosatto L., Belluzzi E., Greggio E., Bisaglia M., Capaldi S., Aioanei D., Mammi S., Monaco H.L., Samorì B., Bubacco L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. I have NOT added results from Supp fig 4 (SDS_PAGE) -text states:- ".....show that the amount of soluble aS is lower at the end of the reaction" - you may disagree - but I can see very little evidence for this - both bands look much the same, or not significantly different to me, and NO measurements are given... Experiments containing 14-3-3 theta and gamma isoforms have not been included as the origins of the proteins cannot be determined from the publication, and the author has not replied to a request for information. Similarly interactions involving the pEBG 14-3-3- plasmid used for 293T cell transfections, have not been included (Figure 6). luigi.bubacco@unipd.it Accepted 2014-NOV-24 by ORCHARD Hum. Mol. Genet. (0964-6906) 2014 Only protein-protein interactions imex curation The chaperone-like protein 14-3-3η interacts with human α-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing α-synuclein cellular toxicity. The chaperone-like protein 14-3-3η interacts with human α-synuclein aggregation intermediates rerouting the amyloidogenic pathway and reducing α-synuclein cellular toxicity. Hum. Mol. Genet. (0964-6906) 2014 imex curation Plotegher N., Kumar D., Tessari I., Brucale M., Munari F., Tosatto L., Belluzzi E., Greggio E., Bisaglia M., Capaldi S., Aioanei D., Mammi S., Monaco H.L., Samorì B., Bubacco L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Parkinsons - Interactions investigated in the context of Parkinsons disease I have NOT added results from Supp fig 4 (SDS_PAGE) -text states:- ".....show that the amount of soluble aS is lower at the end of the reaction" - you may disagree - but I can see very little evidence for this - both bands look much the same, or not significantly different to me, and NO measurements are given... Experiments containing 14-3-3 theta and gamma isoforms have not been included as the origins of the proteins cannot be determined from the publication, and the author has not replied to a request for information. Similarly interactions involving the pEBG 14-3-3- plasmid used for 293T cell transfections, have not been included (Figure 6). luigi.bubacco@unipd.it 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Plotegher N., Kumar D., Tessari I., Brucale M., Munari F., Tosatto L., Belluzzi E., Greggio E., Bisaglia M., Capaldi S., Aioanei D., Mammi S., Monaco H.L., Samorì B., Bubacco L. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. I have NOT added results from Supp fig 4 (SDS_PAGE) -text states:- ".....show that the amount of soluble aS is lower at the end of the reaction" - you may disagree - but I can see very little evidence for this - both bands look much the same, or not significantly different to me, and NO measurements are given... Type 1 AS seeds (small aggregates) were added to cells. Experiments containing 14-3-3 theta and gamma isoforms have not been included as the origins of the proteins cannot be determined from the publication, and the author has not replied to a request for information. Similarly interactions involving the pEBG 14-3-3- plasmid used for 293T cell transfections, have not been included (Figure 6). luigi.bubacco@unipd.it Accepted 2014-NOV-24 by ORCHARD Hum. Mol. Genet. (0964-6906) 2014 Only protein-protein interactions imex curation 1433f_human 14-3-3 protein eta YWHAH YWHA1 Protein AS1 protein protein human Homo sapiens Human MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN DIP protein Q04917 original sequence version: 166 DIP protein Q04917 original sequence version: 168 DIP protein Q04917 original sequence version: 175 D70FBC100C45D6E5 p37840-1 Alpha-synuclein NACP140 SNCA NACP PARK1 Non-A beta component of AD amyloid Non-A4 component of amyloid precursor protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA DIP protein P37840-1 original sequence version: 101 DIP protein P37840-1 original sequence version: 192 6BB2F12128931663 tht Thioflavin T small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) syua_human Alpha-synuclein Non-A beta component of AD amyloid Non-A4 component of amyloid precursor SNCA NACP PARK1 protein protein human Homo sapiens Human MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA DIP protein P37840 original sequence version: 124 DIP protein P37840 original sequence version: 175 DIP protein P37840 original sequence version: 178 6BB2F12128931663 snca-snca-38 1 10 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Supp 1 snca-snca-39 2 8 inhibitor inhibitor neutral component neutral component ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component c_terminus oregon green label oregon green label c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component c_terminus oregon green label oregon green label c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 1Cii 14-3-3-eta is stated to be a homodimer Q04917 decreases binding of P37840-1 to P37840-1 snca-snca-39 2 9 unspecified role unspecified role neutral component neutral component c_terminus oregon green label oregon green label c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component c_terminus oregon green label oregon green label c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) physical association physical association 1A, supp fig 6. snca-snca-49 2 8 inhibitor inhibitor neutral component neutral component c_terminus oregon green label oregon green label c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association 1Ci 14-3-3-eta is stated to be a homodimer. 14-3-3η appears to inhibit aS aggregation. snca-snca-41 1 10 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 8 inhibitor inhibitor neutral component neutral component ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Supp 1 snca-snca-50 4 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Figure 2/4/5 Immuno-gold experiments show the presence of 14-3-3 molecules inside the sub-fibrillar aggregates (NFPs -Non-Fibrillar Products). 14-3-3-eta slows down AS fibril formation when aggregation is promoted by type 1 seeds (consisting of small aggregates), but not when type 2 seeds (mature fibrillar fragments) are used. However gold particles were observed in samples containing Type 2 seeds and these were in close contact with long mature fibrils. snca-snca-42 4 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction Fig 2/4/5 snca-snca-43 6 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 8 inhibitor inhibitor neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig 3/5 Supp 2 As the relative amount of 14-3-3-eta increases, the height distributions of aggregation products gradually shift toward lower diameters. 14-3-3-eta slows down AS fibril formation when aggregation is promoted by type 1 seeds (consisting of small aggregates), but not when type 2 seeds (mature fibrillar fragments) are used. snca-snca-43 6 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Fig 3, Supp 2. snca-snca-44 5 8 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp 7C snca-3 7 11 unspecified role unspecified role neutral component neutral component c_terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 11 unspecified role unspecified role neutral component neutral component c_terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range colocalization colocalization 6B In the absence of seed treatment aggregates do not form. snca-snca-45 7 11 unspecified role unspecified role neutral component neutral component c_terminus egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role neutral component neutral component n_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range colocalization colocalization 6C/D snca-snca-51 3 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component c_terminus his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Supp 4 The amount of soluble aS is lower at the end of the reaction. snca-snca-47 2 9 unspecified role unspecified role neutral component neutral component c_terminus oregon green label oregon green label c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 8 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Supp Fig 6 snca-snca-48 2 8 inhibitor inhibitor neutral component neutral component c_terminus oregon green label oregon green label c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 9 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association Supp fig 6