MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it PEX14 binding to Arabidopsis PEX5 has differential effects on PTS1 and PTS2 cargo occupancy of the receptor. PEX14 binding to Arabidopsis PEX5 has differential effects on PTS1 and PTS2 cargo occupancy of the receptor. FEBS Lett. (0014-5793) 2014 imex curation Lanyon-Hogg T., Hooper J., Gunn S., Warriner S.L., Baker A. a.baker@leeds.ac.uk 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western a.baker@leeds.ac.uk Accepted 2014-MAY-21 by LUANA 2014 imex curation PEX14 binding to Arabidopsis PEX5 has differential effects on PTS1 and PTS2 cargo occupancy of the receptor. PEX14 binding to Arabidopsis PEX5 has differential effects on PTS1 and PTS2 cargo occupancy of the receptor. FEBS Lett. (0014-5793) 2014 imex curation Lanyon-Hogg T., Hooper J., Gunn S., Warriner S.L., Baker A. a.baker@leeds.ac.uk 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot a.baker@leeds.ac.uk Accepted 2014-MAY-21 by LUANA 2014 imex curation PEX14 binding to Arabidopsis PEX5 has differential effects on PTS1 and PTS2 cargo occupancy of the receptor. PEX14 binding to Arabidopsis PEX5 has differential effects on PTS1 and PTS2 cargo occupancy of the receptor. FEBS Lett. (0014-5793) 2014 imex curation Lanyon-Hogg T., Hooper J., Gunn S., Warriner S.L., Baker A. a.baker@leeds.ac.uk 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro filter binding filter binding Filter overlay assay Filter overlay assay tag enzyme assay tag visualisation by enzyme assay tag enzyme assay a.baker@leeds.ac.uk Accepted 2014-MAY-21 by LUANA 2014 imex curation pex5_arath Peroxisome biogenesis protein 5 At5g56290 PEX5 Peroxin-5 Peroxisomal targeting signal type 1 receptor Pex5p MXK23.3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MAMRDLVNGGAACAVPGSSSSSNPLGALTNALLGSSSKTQERLKEIPNANRSGPRPQFYSEDQQIRSLPGSELDQPLLQPGAQGSEFFRGFRSVDQNGLGAAWDEVQQGGPMPPMGPMFEPVQPTFEGPPQRVLSNFLHSFVESSRGGIPFRPAPVPVLGLSQSDKQCIRDRSSIMARHFFADRGEEFINSQVNALLSSLDIDDGIQARGHVPGRFRELDDYWNESQAVVKPNLHPADNWAAEFNQHGMDHGGPDSWVQSFEQQHGVNGWATEFEQGQSQLMSSQMRSMDMQNIAAMEQTRKLAHTLSQDGNPKFQNSRFLQFVSKMSRGELIIDENQVKQASAPGEWATEYEQQYLGPPSWADQFANEKLSHGPEQWADEFASGRGQQETAEDQWVNEFSKLNVDDWIDEFAEGPVGDSSADAWANAYDEFLNEKNAGKQTSGVYVFSDMNPYVGHPEPMKEGQELFRKGLLSEAALALEAEVMKNPENAEGWRLLGVTHAENDDDQQAIAAMMRAQEADPTNLEVLLALGVSHTNELEQATALKYLYGWLRNHPKYGAIAPPELADSLYHADIARLFNEASQLNPEDADVHIVLGVLYNLSREFDRAITSFQTALQLKPNDYSLWNKLGATQANSVQSADAISAYQQALDLKPNYVRAWANMGISYANQGMYKESIPYYVRALAMNPKADNAWQYLRLSLSCASRQDMIEACESRNLDLLQKEFPL 12EF434E8C06DDFB pex7_arath Peroxisome biogenesis protein 7 Peroxin-7 Peroxisomal targeting signal type 2 receptor Pex7p F28N24.6 At1g29260 PEX7 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MPVFKAPFNGYSVKFSPFYESRLAVATAQNFGILGNGRIHVLELAPGAPGVTESVSYDTADAVYDVCWSESHDSVLIAAIGDGSVKIYDTALPPPSNPIRSFQEHAREVQSVDYNPTRRDSFLTSSWDDTVKLWAMDRPASVRTFKEHAYCVYQAVWNPKHGDVFASASGDCTLRIWDVREPGSTMIIPAHDFEILSCDWNKYDDCILATSSVDKTVKVWDVRSYRVPLAVLNGHGYAVRKVKFSPHRRSLIASCSYDMSVCLWDYMVEDALVGRYDHHTEFAVGIDMSVLVEGLMASTGWDELVYVWQQGMDPRAS dci1_arath Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, peroxisomal DCI1 At5g43280 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MTMESYKTLEIIRKNTDSSVFHLIINRPSHLNALSLDFFIEFPKALSSLDQNPDVSVIILSGAGKHFCSGIDLNSLSSISTQSSSGNDRGRSSEQLRRKIKSMQAAITAIEQCRKPVIAAIHGACIGGGVDLITACDIRYCSEDAFFSIKEVDLAIVADLGTLQRLPSIVGYANAMELALTARRFSGSEAKDLGLVSKVFGSKSELDNGVTTIAEGIGGKSPLAVTGTKAVLLRSREVSVEQGLDYVATWNSAMLISDDLNEAVSAQMMKRKPRFAKL 5118850A71C4725B thik2_arath 3-ketoacyl-CoA thiolase 2, peroxisomal PED1 KAT2 Acetyl-CoA acyltransferase 2 Beta-ketothiolase 2 Peroxisomal 3-oxoacyl-CoA thiolase 2 Peroxisome defective protein 1 F25I18.11 At2g33150 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MEKAIERQRVLLEHLRPSSSSSHNYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNPAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPVKTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR 7405F81968489ADB pex14_arath Peroxisomal membrane protein PEX14 PEX14 PED2 Peroxin-14 Peroxisome biogenesis protein 14 Pex14p Protein PEROXISOME DEFECTIVE 2 MQB2.13 At5g62810 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MATHQQTQPPSDFPALADENSQIPEATKPANEVQQATIAQDPPTSVFKNSEPIREDQIQNAIKFLSHPRVRGSPVIHRRSFLERKGLTKEEIDEAFRRVPDPPPSSQTTVTTSQDGQQAVSTVQPQAMQPVVAAPAPLIVTPQAAFLSRFRWYHAILAVGVLAASGAGTAVFIKRSLIPRFKSWVQRIMLEEETDPLKKADAKPSLAEEAVAAAKAASAAASDVARVSQEMMITKNEERKYFEDLTHLLGVQVQEMKSLSNNIRKLEGQSNNIPKIYSADQEVYNGSVTTARKPYTNGSNVDYDTRSARSASPPAAPADSSAPPHPKSYMDIMSMIQRGEKPSNIREINDMPPNPNQPLSDPRIAPKSKPWDYGQAPQDESSNGQWWQQKNPRSTDFGYETTTAARFTANQNETSTMEPAAFQRQRSWVPPQPPPVAMAEAVEAIRRPKPQAKIDQEAAASDGQSGVSDELQKITKFSESGGDGSGGIKIAEIQEETEQQHISQEGN q0wus4_arath Malate dehydrogenase At2g22780 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MDPNQRIARISAHLNPPNLHNQIADGSGLNRVACRAKGGSPGFKVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVANAPGVTADISHMDTSAVVRGFLGQPQLEEALTGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLSEAIAKCCPKAIVNIISNPVNSTVPIAAEVFKKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVEVPVVGGHAGVTILPLLSQVKPPCSFTQKEIEYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAVEFADACLRGLRGDANIVECAYVASHVTELPFFASKVRLGRCGIDEVYGLGPLNEYERMGLEKAKKELSVSIHKGVTFAKK pex14-pex5-12 1 PEX14N 8 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his-strep tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PEX5 4 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1b f1c A stable ternary PTS1-PEX5C-PEX14N complex was isolated (Fig 1B lane 1), and PEX14N could also co-isolate PEX5C in the absence of lissamine-PTS1 cargo (Fig. 1B, lane 2). The pull-down experiments were repeated utilising full-length PEX5. These experiments demonstrated that PEX5 was also capable of forming a stable ternary complex, or binding PEX14N in the absence of PTS1 cargo (Fig. 1C, lanes 1 and 2). pex5-pex14-5 3 PEX14N 8 tag enzyme assay tag visualisation by enzyme assay tag enzyme assay tag enzyme assay tag visualisation by enzyme assay tag enzyme assay unspecified role unspecified role prey prey purified purified hrp tag enzyme tag enzyme tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PEX5 4 predetermined predetermined participant predetermined tag enzyme assay tag visualisation by enzyme assay tag enzyme assay unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined direct interaction direct interaction f1d A stable ternary PTS1-PEX5C-PEX14N complex was isolated (Fig 1B lane 1), and PEX14N could also co-isolate PEX5C in the absence of lissamine-PTS1 cargo (Fig. 1B, lane 2). The pull-down experiments were repeated utilising full-length PEX5. These experiments demonstrated that PEX5 was also capable of forming a stable ternary complex, or binding PEX14N in the absence of PTS1 cargo (Fig. 1C, lanes 1 and 2). pex5-pex7 2 PEX7 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level PEX5 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3 The PEX5C terminal construct lacks residues 314 to 334 which are required for function as the PEX7 co-receptor [9]. As predicted, pull-down from the depleted cytosol with recombinant PEX5C did not co-isolate either PEX7 or thiolase cargo (Fig. 3B, anti-PEX7 and anti-thiolase panels). dci1-ped1 2 PEX5 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level DCI1 6 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4a pex5-ped1 2 thiolase PTS2-cargo 7 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level PEX5 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3 The PEX5C terminal construct lacks residues 314 to 334 which are required for function as the PEX7 co-receptor [9]. As predicted, pull-down from the depleted cytosol with recombinant PEX5C did not co-isolate either PEX7 or thiolase cargo (Fig. 3B, anti-PEX7 and anti-thiolase panels). dci1-pex5 2 PEX7 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level DCI1 6 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f4a dci1-ped1-1 2 DCI1 6 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined thiolase PTS2-cargo 7 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4a dci1-pex5-1 2 PEX14N 8 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PEX5 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4c pex14-pex5-13 2 PEX14N 8 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain PEX7 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4c dci1-pex7 2 pMDH1 9 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PEX7 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4B dci1-pex5-2 2 pMDH1 9 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined PEX5 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey subcellular prep subcellular preparation subcellular prep physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f4B