IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Cell (0092-8674) 2014 imex curation Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro biophysical biophysical predetermined predetermined participant predetermined Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. Melting temperature determination by thermofluor analysis achim.kramer@charite.de, evawolf1@uni-mainz.de Accepted 2014-SEP-03 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Cell (0092-8674) 2014 imex curation Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de Accepted 2014-SEP-03 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Cell (0092-8674) 2014 imex curation Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro chromatography chromatography technology column chromatography chromatography ms participant Identification by mass spectrometry ms participant Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de Accepted 2014-SEP-03 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Cell (0092-8674) 2014 imex curation Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. An X-ray fluorescence scan was used to confirm the presence of zinc achim.kramer@charite.de, evawolf1@uni-mainz.de Accepted 2014-SEP-03 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Cell (0092-8674) 2014 imex curation Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de Accepted 2014-SEP-03 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Cell (0092-8674) 2014 imex curation Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro biophysical biophysical predetermined predetermined participant predetermined Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. Inductively coupled plasma atomic emission spectroscopy (ICP-AES), also referred to as inductively coupled plasma optical emission spectrometry (ICP-OES), is an analytical technique used for the detection of trace metals. It is a type of emission spectroscopy that uses the inductively coupled plasma to produce excited atoms and ions that emit electromagnetic radiation at wavelengths characteristic of a particular element. The zinc-specific wavelength = 213.857 nm achim.kramer@charite.de, evawolf1@uni-mainz.de Accepted 2014-SEP-03 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Cell (0092-8674) 2014 imex curation Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by staining molecular weight estimation by staining weight by staining Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de Accepted 2014-SEP-03 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Cell (0092-8674) 2014 imex curation Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip tag visualisation tag visualisation Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de Accepted 2014-SEP-03 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Cell (0092-8674) 2014 imex curation Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de Accepted 2014-SEP-03 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Interaction of circadian clock proteins CRY1 and PER2 is modulated by zinc binding and disulfide bond formation. Cell (0092-8674) 2014 imex curation Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down weight by comassie molecular weight estimation by coomasie staining weight by comassie Schmalen I., Reischl S., Wallach T., Klemz R., Grudziecki A., Prabu J.R., Benda C., Kramer A., Wolf E. achim.kramer@charite.de, evawolf1@uni-mainz.de Accepted 2014-SEP-03 by MGT Cell (0092-8674) 2014 Only protein-protein interactions imex curation cry1_mouse Cryptochrome-1 Cry1 protein protein mouse Mus musculus Mouse MGVNAVHWFRKGLRLHDNPALKECIQGADTIRCVYILDPWFAGSSNVGINRWRFLLQCLEDLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEAGVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLVSKMEPLEMPADTITSDVIGKCMTPLSDDHDEKYGVPSLEELGFDTDGLSSAVWPGGETEALTRLERHLERKAWVANFERPRMNANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAATNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGRRTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLNIERMKQIYQQLSRYRGLGLLASVPSNSNGNGGLMGYAPGENVPSCSSSGNGGLMGYAPGENVPSCSGGNCSQGSGILHYAHGDSQQTHSLKQGRSSAGTGLSSGKRPSQEEDAQSVGPKVQRQSSN DIP protein P97784 original sequence version: 119 DIP protein P97784 original sequence version: 108 DIP protein P97784 original sequence version: 86 DIP protein P97784 original sequence version: 110 DIP protein P97784 original sequence version: 113 DIP protein P97784 original sequence version: 125 DIP protein P97784 original sequence version: 130 DIP protein P97784 original sequence version: 95 2F2B8DD53F0A9AF9 zinc(2+) zinc(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) per2_mouse Period circadian protein homolog 2 Per2 Circadian clock protein PERIOD 2 protein protein mouse Mus musculus Mouse MNGYVDFSPSPTSPTKEPGAPQPTQAVLQEDVDMSSGSSGNENCSTGRDSQGSDCDDNGKELRMLVESSNTHPSPDDAFRLMMTEAEHNPSTSGCSSEQSAKADAHKELIRTLKELKVHLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSESQPCSVDVPSYSMEQVEGITSEYIVKNADMFAVAVSLVSGKILYISNQVASIFHCKKDAFSDAKFVEFLAPHDVSVFHSYTTPYKLPPWSVCSGLDSFTQECMEEKSFFCRVSVGKHHENEIRYQPFRMTPYLVKVQEQQGAESQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQAVDERAVPLLGYLPQDLIETPVLVQLHPSDRPLMLAIHKKILQAGGQPFDYSPIRFRTRNGEYITLDTSWSSFINPWSRKISFIIGRHKVRVGPLNEDVFAAPPCPEEKTPHPSVQELTEQIHRLLMQPVPHSGSSGYGSLGSNGSHEHLMSQTSSSDSNGQEESHRRRSGIFKTSGKIQTKSHVSHESGGQKEASVAEMQSSPPAQVKAVTTIERDSSGASLPKASFPEELAYKNQPPCSYQQISCLDSVIRYLESCSEAATLKRKCEFPANIPSRKATVSPGLHSGEAARPSKVTSHTEVSAHLSSLTLPGKAESVVSLTSQCSYSSTIVHVGDKKPQPELETVEDMASGPESLDGAAGGLSQEKGPLQKLGLTKEVLAAHTQKEEQGFLQRFREVSRLSALQAHCQNYLQERSRAQASDRGLRNTSGLESSWKKTGKNRKLKSKRVKTRDSSESTGSGGPVSHRPPLMGLNATAWSPSDTSQSSCPSAPFPTAVPAYPLPVFQAPGIVSTPGTVVAPPAATHTGFTMPVVPMGTQPEFAVQPLPFAAPLAPVMAFMLPSYPFPPATPNLPQAFLPSQPHFPAHPTLASEITPASQAEFPSRTSTLRQPCACPVTPPAGTVALGRASPPLFQSRGSSPLQLNLLQLEEAPEGSTGAAGTLGTTGTAASGLDCTSGTSRDRQPKAPPTCNEPSDTQNSDAISTSSDLLNLLLGEDLCSATGSALSRSGASATSDSLGSSSLGFGTSQSGAGSSDTSHTSKYFGSIDSSENNHKAKMIPDTEESEQFIKYVLQDPIWLLMANTDDSIMMTYQLPSRDLQAVLKEDQEKLKLLQRSQPRFTEGQRRELREVHPWVHTGGLPTAIDVTGCVYCESEEKGNICLPYEEDSPSPGLCDTSEAKEEEGEQLTGPRIEAQT DIP protein O54943 original sequence version: 120 DIP protein O54943 original sequence version: 83 DIP protein O54943 original sequence version: 87 DIP protein O54943 original sequence version: 104 DIP protein O54943 original sequence version: 111 DIP protein O54943 original sequence version: 114 DIP protein O54943 original sequence version: 98 554B8AFF036CF7FB cry1-per2-2 2 11 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 20 16 direct interaction direct interaction Supp. Table 1 2.45A Rworking = 0.19 Rfree = 0.23 cry1-per2-4 4 12 unspecified role unspecified role neutral component neutral component 13 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 28 25 direct interaction direct interaction Supp. Fig. 4C cry1-per2-5 6 12 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range ecoli Escherichia coli (strain K12) 33 35 direct interaction direct interaction Supp. Fig. 4D, 7 Only copurified CRY/PER2 complex binds zinc, while single mCRY1 and mPER2 proteins are zinc-free in solution cry1-per2-6 10 11 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 unspecified role unspecified role bait bait n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O54943:p.[Asp1167Arg;Phe1181Arg;His1193Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D R certain certain sequence position certain certain certain sequence position certain H E certain certain sequence position certain certain certain sequence position certain F R Fri Jul 22 11:02:39 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1167arg,his1193glu,phe1181arg' Wed May 02 20:16:44 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1167arg,phe1181arg,his1193glu' Tue Jun 30 16:16:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp1167Arg;Phe1181Arg;His1193Glu]' O54943:p.Asp1167Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D R Wed May 02 20:19:02 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1167arg' Tue Jun 30 16:13:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp1167Arg' O54943:p.[Asp1167Arg;His1193Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain H E certain certain sequence position certain certain certain sequence position certain D R Fri Jul 22 11:01:43 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'his1193glu,asp1167arg' Wed May 02 17:29:57 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1167arg,his1193glu' Tue Jun 30 16:49:01 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp1167Arg;His1193Glu]' ecoli Escherichia coli (strain K12) 42 39 physical association physical association Fig. 5A cry1-per2-10 9 12 unspecified role unspecified role neutral component neutral component 11 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 51 49 direct interaction direct interaction 6B cry1-per2-8 7 13 unspecified role unspecified role neutral component neutral component O54943:p.[Asp1167Arg;His1193Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain H E certain certain sequence position certain certain certain sequence position certain D R Fri Jul 22 10:59:46 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'his1193glu,asp1167arg' Wed May 02 19:26:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1167arg,his1193glu' Tue Jun 30 19:14:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp1167Arg;His1193Glu]' O54943:p.Asp1167Arg mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain D R Wed May 02 19:16:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1167arg' Tue Jun 30 19:46:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp1167Arg' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain O54943:p.[Asp1167Arg;Phe1181Arg;His1193Glu] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain D R certain certain sequence position certain certain certain sequence position certain H E certain certain sequence position certain certain certain sequence position certain F R Fri Jul 22 11:15:26 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1167arg,his1193glu,phe1181arg' Wed May 02 17:35:49 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp1167arg,phe1181arg,his1193glu' Tue Jun 30 20:19:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Asp1167Arg;Phe1181Arg;His1193Glu]' ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 56 59 direct interaction direct interaction Fig. 5C, 5D cry1-per2-9 1 13 unspecified role unspecified role neutral component neutral component O54943:p.[Cys1210Ala;Cys1213Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 19:44:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys1210ala,cys1213ala' Tue Jun 30 18:35:04 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys1210Ala;Cys1213Ala]' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 63 65 direct interaction direct interaction Fig. 6A Zinc binding stabilizes the purified CRY1/PER2 complex as demonstrated by the higher melting temperature of the wild-type complex compared to the zinc-free CRY1/PER2(cys1210ala/cys1213ala) mutant complex per2-zinc_2__ 8 13 unspecified role unspecified role bait bait O54943:p.[Cys1210Ala;Cys1213Ala] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 14:55:59 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys1210ala,cys1213ala' Tue Jun 30 16:39:38 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys1210Ala;Cys1213Ala]' n-terminal v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 11 unspecified role unspecified role ancillary ancillary P97784:p.[Cys412Ala;Cys414Ala] mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain C A certain certain sequence position certain certain certain sequence position certain C A Wed May 02 15:37:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'cys412ala,cys414ala' Tue Jun 30 19:23:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Cys412Ala;Cys414Ala]' human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. 12 unspecified role unspecified role prey prey region radiolabelled radiolabel radiolabeled radiolabelled undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 7C, Supp. Fig. 5B cry1-per2-11 9 11 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 76 78 direct interaction direct interaction 5B cry1-per2-12 3 13 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 82 85 direct interaction direct interaction Supp Fig. 6 cry1-per2-12 3 11 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 13 unspecified role unspecified role neutral component neutral component n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 12 unspecified role unspecified role neutral component neutral component 88 92 direct interaction direct interaction Supp. Fig. 6 The presence of zinc in the complexes was analyzed in parallel by atomic absorption spectroscopy (ICP-OES) cry1-per2-1 5 13 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain trini-high_5 Trichoplusia ni cell line from eggs high_5 Insect cell line from Trichoplusia ni egg cells Invitrogen supplies this cell line. Invitrogen supply this cell line. 96 98 direct interaction direct interaction Supp Table 2 Unbound C-terminal mPER2 region Is mainly unstructured; upon binding to mCRY1-PHR, it adopts a helical fold.