MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein. Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein. FEBS Lett. (0014-5793) 2014 imex curation Zhang J., Zhang H., Gao Z., Hu H., Dong C., Dong Y.H. dongcheng@ihep.ac.cn; dongyh@ihep.ac.cn 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined dongcheng@ihep.ac.cn; dongyh@ihep.ac.cn Accepted 2014-APR-11 by LUANA 2014 imex curation Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein. Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein. FEBS Lett. (0014-5793) 2014 imex curation Zhang J., Zhang H., Gao Z., Hu H., Dong C., Dong Y.H. dongcheng@ihep.ac.cn; dongyh@ihep.ac.cn 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined dongcheng@ihep.ac.cn; dongyh@ihep.ac.cn Accepted 2014-APR-11 by LUANA 2014 imex curation Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein. Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein. FEBS Lett. (0014-5793) 2014 imex curation Zhang J., Zhang H., Gao Z., Hu H., Dong C., Dong Y.H. dongcheng@ihep.ac.cn; dongyh@ihep.ac.cn 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined dongcheng@ihep.ac.cn; dongyh@ihep.ac.cn Accepted 2014-APR-11 by LUANA 2014 imex curation Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein. Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein. FEBS Lett. (0014-5793) 2014 imex curation Zhang J., Zhang H., Gao Z., Hu H., Dong C., Dong Y.H. dongcheng@ihep.ac.cn; dongyh@ihep.ac.cn 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro saxs x ray scattering saxs predetermined predetermined participant predetermined dongcheng@ihep.ac.cn; dongyh@ihep.ac.cn Accepted 2014-APR-11 by LUANA 2014 imex curation Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein. Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein. FEBS Lett. (0014-5793) 2014 imex curation Zhang J., Zhang H., Gao Z., Hu H., Dong C., Dong Y.H. dongcheng@ihep.ac.cn; dongyh@ihep.ac.cn 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined dongcheng@ihep.ac.cn; dongyh@ihep.ac.cn Accepted 2014-APR-11 by LUANA 2014 imex curation tsiv3_vibch Antitoxin protein TsiV3 tsiV3 VC_A0124 protein protein vibch Vibrio cholerae MNNLLSAYVTMLLILLSISGGAIASENCNDTSGVHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDFYSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS 93B79A60BBBEF16F vgrg3_vibch Type VI secretion system spike protein VgrG3 vgrG3 Muramidase Vgrg3C VC_A0123 protein protein vibch Vibrio cholerae MARLQFQLKVDGLEDESLVVRGFEGQESLSDSVWRCEPCYGFRYQVDLASALSNLTAEQFVDQTAHLTILRDGQVVQQINGIVRQLSKGDTGHRHTFYSLTLVPALERLSLRSNSRIFQQQSVPEIISILLQEMGIEDYAFALKRECAQREFCVQYRETDLQFLHRIAAEEGLVYSHLHEAQKHTLLFTDSSDSQPKLAKPVPYNALAGGEINLPYVVDLQFKTTAQVSHTELKDYSFKKPAYGFTQRTQGKDIAYQQPNYEHFDAPGRYKDDANGKAFSQIRLEYLRRDALLADAKSDEPLLLAGVRFDLQDHLDHAMNRDWLVVQANHQGTQPQALQEEGGSGATTYSNQLKLIPAHITWRARPCAKPQVDGPMIATVVGPQGEEIYCDNFGRVKVHFPWDRYSSSNEKSSCWVRVAQEWAGSQYGSMAIPRVGHEVIVSFLNGDPDQPIITGRTYHATNTAPYALPDHKTKTVLRTETHQGQGYNELSFEDQAGSEQILLHAQKDWDALIEHDHTEVIRHDQHLTVDNDRFTRIQRNQHLTVEGEVRSKIALDSSHEVGASLQHKVGQRIAVEAGKEISLKSGAKIVVEAGAELTLKAGGSFVKVDAGGVHLVGPAINLNAGGSAGSGSAYGGQLAAAPRMLAQAKPVAELVQPDIAASMQSGAARVIDVASLPTMMPSSANNTANDEPVAEEKTPERILKSDLLKPSDELEKLAKRQASAYRQGNHSDEVKLLQEALIKLGFDLGKAGADGDFGSKTKTAIEQFQKSYQPSHQTHPSYSIGAVDGIVGKGTLLALDEALMDGWVYENNIYQIWPLGKTSEKYESAGRGPGVISTGNGDYGGASYGCYQMSSNLGVVQKYIQSSKFKEFFSGLNPATKEFNVVWQDIASRYPQEFREEQHQFIKRTHYDIQIGHLRGKGLLFEHNRAAVHDLIWSTSVQFGGRTNLIFNALNGQNMESMTDKDIIILVQDYKLVNTERLFKSSPSWWSDLKKRAVSEKKALLELEIDGLEVDIK ECFF8C66E0214FE4 q9kn41-q9kn42 1 TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain VgrG3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t1 F1C F6A F6B F6C q9kn41-q9kn42-1 2 TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain VgrG3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction F1A q9kn41-q9kn42-2 1 TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction F5B T1 The structure of native TsaB was determined at a resolution of 2.8 Å. There are six molecules in an asymmetric unit, which consists of three TsaB dimers (Figure 5B). q9kn41-q9kn42-3 2 TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction F5A Although dimeric TsaB accounts for most of the total protein, higher oligomeric assemblies also occur in solution. The AUC and gel-filtration results are fully consistent (Figure 5A and Figure 2). q9kn41-q9kn41 2 TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction F5A Although dimeric TsaB accounts for most of the total protein, higher oligomeric assemblies also occur in solution. The AUC and gel-filtration results are fully consistent (Figure 5A and Figure 2). q9kn41-4 3 TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction F2 Although dimeric TsaB accounts for most of the total protein, higher oligomeric assemblies also occur in solution. The AUC and gel-filtration results are fully consistent (Figure 5A and Figure 2). q9kn41-q9kn42-4 3 TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain VgrG3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction F2 q9kn41-q9kn42-5 4 TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain VgrG3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction F1b q9kn41-q9kn42-6 5 TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain VgrG3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t2 q9kn41-q9kn42-7 5 TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain VgrG3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9KN42:p.Tyr826Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Y A Wed May 02 18:29:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'tyr826ala' Tue Jun 30 17:13:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Tyr826Ala' direct interaction direct interaction t2 q9kn41-q9kn42-8 5 TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain VgrG3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9KN42:p.Asp842Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain D A Wed May 02 15:55:34 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'asp842ala' Tue Jun 30 16:42:50 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Asp842Ala' direct interaction direct interaction t2 q9kn41-q9kn42-9 5 VgrG3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9KN42:p.Val941Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain V A Wed May 02 14:31:20 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val941ala' Tue Jun 30 19:30:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val941Ala' TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t2 q9kn41-q9kn42-10 5 VgrG3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Q9KN42:p.Gln942Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain Q A Wed May 02 15:13:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln942ala' Tue Jun 30 16:37:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln942Ala' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t2 q9kn41-q9kn42-11 5 VgrG3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9KN42:p.Leu982Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A Wed May 02 17:33:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu982ala' Tue Jun 30 17:12:58 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu982Ala' TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t2 q9kn41-q9kn42-12 5 TsaB 6 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain VgrG3 7 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Q9KN42:p.Arg996Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:48:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg996ala' Tue Jun 30 17:29:22 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg996Ala' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction t2