MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it The X-ray crystal structure of Shewanella oneidensis OmcA reveals new insight at the microbe-mineral interface. The X-ray crystal structure of Shewanella oneidensis OmcA reveals new insight at the microbe-mineral interface. FEBS Lett. (0014-5793) 2014 imex curation Edwards M.J., Baiden N., Johs A., Tomanicek S.J., Liang L., Shi L., Fredrickson J.K., Zachara J.M., Gates A.J., Butt J.N., Richardson D.J., Clarke T.A. d.richardson@uea.ac.uk 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined d.richardson@uea.ac.uk Accepted 2014-APR-07 by LUANA 2014 imex curation q8eg33_sheon omcA SO_1779 protein protein sheon Shewanella oneidensis (strain MR-1) MMKRFNFNTATKAMLGAGLLSLLLTGCGGSDGKDGEDGKPGVVGVNINSTSTLKAKFTNATVDAGKVTVNFTLENANGVAVLGLTKDHDLRFGIAQLTPVKEKVGETEADRGYQWQAYINAKKEPGTVPSGVDNLNPSTQFQANVESANKCDTCLVDHGDGSYSYTYQVNVANVTEPVKVTYSADATQRATMELELPQLAANAHFDWQPSTGKTEGIQTRNVVSIQACYTCHQPESLALHGGRRIDIENCASCHTATSGDPESGNSIEFTYMIHAIHKGGERHTFDATGAQVPAPYKIIGYGGKVIDYGKVHYPQKPAADCAACHVEGAGAPANADLFKADLSNQACIGCHTEKPSAHHSSTDCMACHNATKPYGGTGSAAKRHGDVMKAYNDSLGYKAKFSNIGIKNNALTFDVQILDNKDQPIGKEFISDPSAYTKSSIYFSWGIDKDYPAYTAGSRYSDRGFALSNSKVSTYNEATKTFTIDSTNSNLKLPADLTGMNVELYAGVATCFNKGGYGVEDVVATPCSTDTRYAYIQDQPFRFKWNGTDTNSAAEKRRAIIDTAKCSGCHNKEIVHYDNGVNCQACHTPDKGLKTDNTYPGTKVPTSFAWKAHESEGHYLKYAGVQSGTVLKTDCATCHTADKSNVVTGIALGRSPERAWLYGDIKNNGAVIWVSSDAGACLSCHQKYLSDAAKSHIETNGGILNGTSAADVQTRASESCATCHTPSQLMEAHGN 6B5FBEEDA74A26EB omca 1 OmcA 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction t1 f1 f2 sf3 sf4 sf5 The crystal structure of OmcA reveals four molecules in the asymmetric unit giving a solvent content of 73% (Fig. S3). Superposition of the four OmcA molecules revealed that the overall RMSD between the main-chain atoms of each monomer were less than 0.5 Å, indicating no significant structural differences between the monomers of the asymmetric unit. Analysis of the arrangement of the four OmcA molecules in the asymmetric unit reveals two different orientations where the four monomers can be arranged in two structurally conserved OmcA dimers (Fig. S4).