MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Crystal structure of FtsA from Staphylococcus aureus. Crystal structure of FtsA from Staphylococcus aureus. FEBS Lett. (0014-5793) 2014 imex curation Fujita J., Maeda Y., Nagao C., Tsuchiya Y., Miyazaki Y., Hirose M., Mizohata E., Matsumoto Y., Inoue T., Mizuguchi K., Matsumura H. matsumura@chem.eng.osaka-u.ac.jp 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined matsumura@chem.eng.osaka-u.ac.jp Accepted 2014-APR-07 by LUANA 2014 imex curation Crystal structure of FtsA from Staphylococcus aureus. Crystal structure of FtsA from Staphylococcus aureus. FEBS Lett. (0014-5793) 2014 imex curation Fujita J., Maeda Y., Nagao C., Tsuchiya Y., Miyazaki Y., Hirose M., Mizohata E., Matsumoto Y., Inoue T., Mizuguchi K., Matsumura H. matsumura@chem.eng.osaka-u.ac.jp 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by staining molecular weight estimation by staining weight by staining matsumura@chem.eng.osaka-u.ac.jp Accepted 2014-APR-07 by LUANA 2014 imex curation Crystal structure of FtsA from Staphylococcus aureus. Crystal structure of FtsA from Staphylococcus aureus. FEBS Lett. (0014-5793) 2014 imex curation Fujita J., Maeda Y., Nagao C., Tsuchiya Y., Miyazaki Y., Hirose M., Mizohata E., Matsumoto Y., Inoue T., Mizuguchi K., Matsumura H. matsumura@chem.eng.osaka-u.ac.jp 11-Jun-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined matsumura@chem.eng.osaka-u.ac.jp Accepted 2014-APR-07 by LUANA 2014 imex curation ftsz_staar Cell division protein FtsZ ftsZ SAR1162 protein protein strain mrsa252 Staphylococcus aureus MLEFEQGFNHLATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFDDKPTSHGRKSGSTGFGTSVNTSSNATSKDESFTSNSSNAQATDSVSERTHTTKEDDIPSFIRNREERRSRRTRR A1E97FCC5C232440 ftsa_staar Cell division protein FtsA ftsA SAR1161 protein protein strain mrsa252 Staphylococcus aureus MEEHYYVSIDIGSSSVKTIVGEKFHNGINVIGTGQTYTSGIKNGLIDDFDIARQAIKDTIKKASIASGVDIKEVFLKLPIIGTEVYDESNEIDFYEDTEINGSHIEKVLEGIREKNDVQETEVINVFPIRFIVDKENEVSDPKELIARHSLKVEAGVIAIQKSILINMIKCVEACGVDVLDVYSDAYNYGSILTATEKELGACVIDIGEDVTQVAFYERGELVDADSIEMAGRDITDDIAQGLNTSYETAEKVKHQYGHAFYDSASDQDIFTVEQVDSDETVQYTQKDLSDFIEARVEEIFFEVFDVLQDLGLTKVNGGFIVTGGSANLLGVKELLSDMVSEKVRIHTPSQMGIRKPEFSSAISTISSSIAFDELLDYVTINYHDNEETEEDVIDVKDKDNESKLGGFDWFKRKTNKKDTHENEVESSDEEIYQSEDNHQEHKQNHEHVQDKDKEESKFKKLMKSLFE B78B4B26847DC3C4 ftsa-1 1 SaFtsA 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction t1 f1 f2 sf1 sf2 The crystallographic asymmetric unit contains four SaFtsA molecules (chains A, B, C, and D). The A-B and C-D molecules stack head to tail in the crystal, thereby forming two antiparallel filamentous structures (Fig. 2 and Supplementary Fig. S1). ftsa-ftsz-10 2 SaFtsZ 4 weight by staining molecular weight estimation by staining weight by staining weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified SaFtsA 5 weight by staining molecular weight estimation by staining weight by staining weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction sf6 ftsa-ftsz-11 3 SaFtsA 5 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified SaFtsZ 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction sf5