MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Investigations into the auto-FAT10ylation of the bispecific E2 conjugating enzyme USE1. Investigations into the auto-FAT10ylation of the bispecific E2 conjugating enzyme USE1. FEBS J. (1742-464X) 2014 imex curation Aichem A., Catone N., Groettrup M. Annette.Aichem@bitg.ch 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Annette.Aichem@bitg.ch Accepted 2014-FEB-07 by LUANA 2014 imex curation Investigations into the auto-FAT10ylation of the bispecific E2 conjugating enzyme USE1. Investigations into the auto-FAT10ylation of the bispecific E2 conjugating enzyme USE1. FEBS J. (1742-464X) 2014 imex curation Aichem A., Catone N., Groettrup M. Annette.Aichem@bitg.ch 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Annette.Aichem@bitg.ch Accepted 2014-FEB-07 by LUANA 2014 imex curation ubd_human Ubiquitin D UBD Diubiquitin FAT10 Ubiquitin-like protein FAT10 protein protein human Homo sapiens Human MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG 40BE415049920CC6 ube2z_human Ubiquitin-conjugating enzyme E2 Z Ubiquitin-protein ligase Z Ubiquitin carrier protein Z Uba6-specific E2 conjugating enzyme 1 UBE2Z HOYS7 E2 ubiquitin-conjugating enzyme Z protein protein human Homo sapiens Human MAESPTEEAATAGAGAAGPGASSVAGVVGVSGSGGGFGPPFLPDVWAAAAAAGGAGGPGSGLAPLPGLPPSAAAHGAALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV 5AFC148BD8D31356 use1-ubd 1 USE1 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level FAT10 3 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level physical association physical association f2a f2c sf1 sf2 use1-ubd-1 2 USE1 4 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9H832:p.Lys323Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain K R Wed May 02 15:23:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys323arg' Tue Jun 30 18:50:06 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Lys323Arg' FAT10 3 anti tag western anti tag western blot anti tag western western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell his-flag tag tandem tag tandem tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f3 As shown in Fig. 3B, each mutant was still able to form a stable conjugate with FAT10. To compare the amounts of the mutant USE1-FAT10 conjugates, the ECL signals of the USE1-FAT10 conjugates were quantified and normalized to the respective USE1 variants in the lysate (load) (Fig. 3B, C). A statistical analysis revealed significantly lower amounts of USE1-K323R-FAT10 (p-value 0.0156) while all other mutant USE1-FAT10 conjugates did not significantly differ in quantity from wildtype USE1-FAT10