MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermo-oxidative stress, parasite growth and development. A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermo-oxidative stress, parasite growth and development. FEBS J. (1742-464X) 2014 imex curation Sharma S., Jadli M., Singh A., Arora K., Malhotra P. pawanm@icgeb.res.in 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions plaf7 Plasmodium falciparum (isolate 3D7) spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence pawanm@icgeb.res.in Accepted 2014-JAN-27 by LUANA 2014 imex curation A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermo-oxidative stress, parasite growth and development. A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermo-oxidative stress, parasite growth and development. FEBS J. (1742-464X) 2014 imex curation Sharma S., Jadli M., Singh A., Arora K., Malhotra P. pawanm@icgeb.res.in 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro density sedimentation cosedimentation through density gradient density sedimentation western blot western blot Immuno blot Immuno blot pawanm@icgeb.res.in Accepted 2014-JAN-27 by LUANA 2014 imex curation A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermo-oxidative stress, parasite growth and development. A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermo-oxidative stress, parasite growth and development. FEBS J. (1742-464X) 2014 imex curation Sharma S., Jadli M., Singh A., Arora K., Malhotra P. pawanm@icgeb.res.in 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions plaf7 Plasmodium falciparum (isolate 3D7) anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot pawanm@icgeb.res.in Accepted 2014-JAN-27 by LUANA 2014 imex curation A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermo-oxidative stress, parasite growth and development. A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermo-oxidative stress, parasite growth and development. FEBS J. (1742-464X) 2014 imex curation Sharma S., Jadli M., Singh A., Arora K., Malhotra P. pawanm@icgeb.res.in 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions plaf7 Plasmodium falciparum (isolate 3D7) anti bait coip anti bait coimmunoprecipitation anti bait coip de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence pawanm@icgeb.res.in Accepted 2014-JAN-27 by LUANA 2014 imex curation A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermo-oxidative stress, parasite growth and development. A secretory multifunctional serine protease, DegP of Plasmodium falciparum plays an important role in thermo-oxidative stress, parasite growth and development. FEBS J. (1742-464X) 2014 imex curation Sharma S., Jadli M., Singh A., Arora K., Malhotra P. pawanm@icgeb.res.in 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions plaf7 Plasmodium falciparum (isolate 3D7) fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining pawanm@icgeb.res.in Accepted 2014-JAN-27 by LUANA 2014 imex curation sodf_plaf7 Superoxide dismutase [Fe] SODB FeSOD PF08_0071 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MVITLPKLKYALNALSPHISEETLNFHYNKHHAGYVNKLNTLIKDTPFAEKSLLDIVKESSGAIFNNAAQIWNHTFYWDSMGPDCGGEPHGEIKEKIQEDFGSFNNFKEQFSNILCGHFGSGWGWLALNNNNKLVILQTHDAGNPIKDNTGIPILTCDIWEHAYYIDYRNDRASYVKAWWNLVNWNFANENLKKAMQK 0C636B66E6044D3B q8ila4_plaf7 Glucose-6-phosphate isomerase PF3D7_1436000 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MNMEITNLKSYKELVTLSAEEKTKDLKDYLNDKNRSESLIKKFKNFYMDLSRQRYSEKTLNKLVEYAEEVELKKKVEKTFMGEKVNMTENRSVLHTALRIPIEKINTHKIIIDNKNVLEDVHGVLKKIEKYSDDIRNGVIKTCKNTKFKNVICIGIGGSYLGTEFVYEAMKYYYYNMELNKNEKDQVNNFNNNYDQDNVFNVRFLANVDPNDVNRAIQNLDQYDTLVIIISKTFTTAETMLNARSIKKWLSLKIKDDENLSKHMVAVSTNLKLTDEFGISRDNVFEFWDWVGGRFSVTSSVGILPLSIAFGYKNMRNFLNGCHDMDEHFLHADLKENIPVLLALTSFYNSHFFDYKNVAILPYFQNLLKFSAHIQQLSMESNGKSVDRNNQPIHYNTCQVYFGEPGTNGQHSFYQLIHQGQVIPVELIGFKHSHFPIKFDKEVVSNHDELMTNFFAQADALAIGKTYEQVKEENEKNKMSPELLTHKVFNGNRPSTLLLFDELNFYTCGLLLSLYESRIVAEGFLLNINSFDQWGVELGKVLAKEVRNYFNDTRNQKKSDNTYNFNESTKILLNYYLSK 74F92B6ED4134238 oat_plaf7 Ornithine aminotransferase OAT Ornithine--oxo-acid aminotransferase PFF0435w protein protein plaf7 Plasmodium falciparum (isolate 3D7) MDFVKELKSSQDYMNNELTYGAHNYDPIPVVLKRGKGVFVYDIEDRRYYDFLSAYSSVNQGHCHPDILNAMINQAKKLTICSRAFFSDSLGVCERYLTNLFGYDKVLMMNTGAEASETAYKLCRKWGYEVKKIPENSAKIIVCNNNFSGRTLGCVSASTDKKCKNNFGPFVPNFLKVPYDDLEALEKELQDPNVCAFIVEPVQGEAGVIVPSDSYFPGVASLCKKYNVLFVADEVQTGLGRTGKLLCTHHYGVKPDVILLGKALSGGHYPISAILANDDVMLVLKPGEHGSTYGGNPLAAAICVEALKVLINEKLCENADKLGAPFLQNLKEQLKDSKVVREVRGKGLLCAIEFKNDLVNVWDICLKFKENGLITRSVHDKTVRLTPPLCITKEQLDECTEIIVKTVKFFDDNL EA2264D1FA264DBF q8ib24_plaf7 PF3D7_0818900 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MASAKGSKPNLPESNIAIGIDLGTTYSCVGVWRNENVDIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVARNPENTVFDAKRLIGRKFTESSVQSDMKHWPFTVKSGVDEKPMIEVTYQGEKKLFHPEEISSMVLQKMKENAEAFLGKSIKNAVITVPAYFNDSQRQATKDAGTIAGLNVMRIINEPTAAAIAYGLHKKGKGEKNILIFDLGGGTFDVSLLTIEDGIFEVKATAGDTHLGGEDFDNRLVNFCVEDFKRKNRGKDLSKNSRALRRLRTQCERAKRTLSSSTQATIEIDSLFEGIDYSVTVSRARFEELCIDYFRDTLIPVEKVLKDAMMDKKSVHEVVLVGGSTRIPKIQTLIKEFFNGKEACRSINPDEAVAYGAAVQAAILSGDQSNAVQDLLLLDVCSLSLGLETAGGVMTKLIERNTTIPAKKSQIFTTYADNQPGVLIQVYEGERALTKDNNLLGKFHLDGIPPAPRKVPQIEVTFDIDANGILNVTAVEKSTGKQNHITITNDKGRLSQDEIDRMVNDAEKYKAEDEENRKRIEARNSLENYCYGVKSSLEDQKIKEKLQPAEIETCMKTITTILEWLEKNQLAGKDEYEAKQKEAESVCAPIMSKIYQDAAGAAGGMPGGMPGGMPGGMPGGMNFPGGMPGAGMPGNAPAGSGPTVEEVD 2C2D3F3C91C8E2CE q8iar5_plaf7 PF3D7_0807700 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MDIIFCTPTYCKIMLMIIMLISLRTRCDTNNFLNCSVEKEEGEEEIISTNLKRINDDMNILGRILNDERNIKITDIVEMLQNEYDDKKKKKKKKKYIYRKKKSNNKINEINSVQHFNVKENILNEKKKNPLNDNFKNPKLRKHSPNNKKNKNKIGQIKFHIVGYDKKKITKYLTPSMISSIQKRLMNKNKKTNVNVNMSNGRVLPFFPKEYFLHSSTHEKKDKMATKKNNKEESIINERLLENLENISLSRTIKDIRGEEGNERKVKEEDNNIKEEGNSFKKYFKGVVKLYVDITEPNLEMIWQNYPPKSITGSGFIIEGHLIITNAHNISYSTRILIRKHGNSGKYEAKILYVAHDVDIAILTTDDKTFFDDVYALHFGALPSLKDEIITIGYPAGGDKLSVTEGIVSRIDVQYYKHSNYKFLLTQIDAPLNPGNSGGPALVRGKVVGICFQSYKVSNNISYIIPSTIISHFLLDIHKNKDYTGYAFLGVKYEPLENPSLREALGLEEMERKKIIKKNVGILITEVFEGHMSKQDDKYHDMDNKHHNVGDTHHNVGDTHHNVGDDHTDNLQGDTDYCTYILNSNIITSDKKNIYSDKKKKKIYSDNNNNNNNFNYYYNMHGEDEQSCYGLKKNDIILRVDGKDINNDGSVILRDNETVGFQHLFNEKFINDLCIIKIVRNKKIKSVMVKLYKVKYLLNQHNWDKRNKYFIYGGIVFSILTRSLYVYTQNPEINKLMLYNNFKKKSKDEIVVLKNILPTKITTGYYYTDSIVLRVNNIKVKNLKHLIELIEMTKYTNRLMYLKNNKHTLQSYINYYNTKITSLNINTIIHILILTTSGQKVPIVLNKRDVEKYNEEIKKIYSITRDRYVY 50A25DD84EC772D6 eno_plaf7 Enolase 2-phosphoglycerate dehydratase 2-phospho-D-glycerate hydro-lyase ENO PF10_0155 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MAHVITRINAREILDSRGNPTVEVDLETNLGIFRAAVPSGASTGIYEALELRDNDKSRYLGKGVQKAIKNINEIIAPKLIGMNCTEQKKIDNLMVEELDGSKNEWGWSKSKLGANAILAISMAVCRAGAAANKVSLYKYLAQLAGKKSDQMVLPVPCLNVINGGSHAGNKLSFQEFMIVPVGAPSFKEALRYGAEVYHTLKSEIKKKYGIDATNVGDEGGFAPNILNANEALDLLVTAIKSAGYEGKVKIAMDVAASEFYNSENKTYDLDFKTPNNDKSLVKTGAQLVDLYIDLVKKYPIVSIEDPFDQDDWENYAKLTAAIGKDVQIVGDDLLVTNPTRITKALEKNACNALLLKVNQIGSITEAIEACLLSQKNNWGVMVSHRSGETEDVFIADLVVALRTGQIKTGAPCRSERNAKYNQLLRIEESLGNNAVFAGEKFRLQLN 21ED9FF01BA50DB2 q76nm3_plaf7 L-lactate dehydrogenase PF3D7_1324900 protein protein plaf7 Plasmodium falciparum (isolate 3D7) MAPKAKIVLVGSGMIGGVMATLIVQKNLGDVVLFDIVKNMPHGKALDTSHTNVMAYSNCKVSGSNTYDDLAGADVVIVTAGFTKAPGKSDKEWNRDDLLPLNNKIMIEIGGHIKKNCPNAFIIVVTNPVDVMVQLLHQHSGVPKNKIIGLGGVLDTSRLKYYISQKLNVCPRDVNAHIVGAHGNKMVLLKRYITVGGIPLQEFINNKLISDAELEAIFDRTVNTALEIVNLHASPYVAPAAAIIEMAESYLKDLKKVLICSTLLEGQYGHSDIFGGTPVVLGANGVEQVIELQLNSEEKAKFDEAIAETKRMKALA D25EB863954B8FC1 q8iar5-q8ib24 2 PfHsp-70 9 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level PfDegP 10 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level colocalization colocalization f5a q8iar5-q8ib24-1 5 PfDegP 10 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell PfHsp-70 9 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f5b q8iar5-q8ib24-2 5 PfDegP 10 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell PfEno 11 immunostaining immunostaining immunostaining immunostaining unspecified role unspecified role neutral component neutral component physiological level physiological level endogenous level endogenous endogenous endogenous level fixed cell fixed cell colocalization colocalization f5c q8iar5-q8ib24-3 3 PfEno 11 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PfDegP 10 predetermined predetermined participant predetermined western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PfHsp-70 9 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f5d eno-oat 4 PfDegP 10 predetermined predetermined participant predetermined de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PfGpi 7 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PfLDH 12 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PfHsp-70 9 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PfOat 8 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PfSod 6 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level PfEno 11 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association sf3b t2 q8iar5-eno 1 PfDegP 10 predetermined predetermined participant predetermined de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role bait bait purified purified PfLDH 12 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level PfGpi 7 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level PfSod 6 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level PfEno 11 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level PfHsp-70 9 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level PfOat 8 de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence de novo protein sequence de novo protein sequencing by mass spectrometry de novo protein sequence unspecified role unspecified role prey prey cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association sf3b t2