MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it NMR analyses on the interactions of the yeast Tim50 C-terminal region with the presequence and Tim50 core domain. NMR analyses on the interactions of the yeast Tim50 C-terminal region with the presequence and Tim50 core domain. FEBS Lett. (0014-5793) 2014 imex curation Rahman B., Kawano S., Yunoki-Esaki K., Anzai T., Endo T. endo@chem.nagoya-u.ac.jp 18-Feb-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined endo@chem.nagoya-u.ac.jp Accepted 2014-JAN-14 by LUANA 2014 imex curation tim50_yeast Mitochondrial import inner membrane translocase subunit TIM50 TIM50 YPL063W protein protein yeast Saccharomyces cerevisiae Baker's yeast MLSILRNSVRLNSRALRVVPSAANTLTSVQASRRLLTSYSSFLQKETKDDKPKSILTDDMLFKAGVDVDEKGQGKNEETSGEGGEDKNEPSSKSEKSRRKRQTSTDIKREKYANWFYIFSLSALTGTAIYMARDWEPQESEELKKDIDNGYTLSLMYKRFKARFNSMFTYFQEPPFPDLLPPPPPPPYQRPLTLVITLEDFLVHSEWSQKHGWRTAKRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKDGVHIKDLSKLNRDLSKVIIIDTDPNSYKLQPENAIPMEPWNGEADDKLVRLIPFLEYLATQQTKDVRPILNSFEDKKNLAEEFDHRVKKLKDKFYGDHKSGGNWAMTALGLGNSLGGSTKFPLDLIHEEGQKNYLMFMKMIEEEKEKIRIQQEQMGGQTFTLKDYVEGNLPSPEEQMKIQLEKQKEVDALFEEEKKKKKIAESK 778D54F5C4ED27C8 778D54F5C4ED27C8 atp9_neucr ATP synthase subunit 9, mitochondrial oli atp-9 atp9 prl-1 Lipid-binding protein B13D24.340 NCU02250 protein protein neucr Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) MASTRVLASRLASQMAASAKVARPAVRVAQVSKRTIQTGSPLQTLKRTQMTSIVNATTRQAFQKRAYSSEIAQAMVEVSKNLGMGSAAIGLTGAGIGIGLVFAALLNGVARNPALRGQLFSYAILGFAFVEAIGLFDLMVALMAKFT 750957A624F50500 tom20_yeast Mitochondrial import receptor subunit TOM20 MOM19 YGR082W TOM20 MAS20 Mitochondrial 20 kDa outer membrane protein Translocase of outer membrane 20 kDa subunit Protein MAS20 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQSNPILRGLAITTAIAALSATGYAIYFDYQRRNSPQFRKVLRQRAKEQAKMEEQAKTHAKEVKLQKVTEFLSMELAKDPIPSDPSEREATFTTNVENGERLSMQQGKELEAASKFYKALTVYPQPADLLGIYQRSIPEAIYEYIILMIAILPPANVASFVKGVVGSKAESDAVAEANDIDD 9F76FE6010278410 oli-tim50 1 Tim50 sPBD 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q02776:p.Glu414Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E A Wed May 02 19:51:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu414ala' Tue Jun 30 19:09:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu414Ala' pSu9N 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f2 f3 f4c oli-tim50-1 1 dTim20 4 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain pSu9N 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f2a oli-tim50-2 1 Tim50 sPBD 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q02776:p.[Ile413Ala;Asp436Ala] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain D A Wed May 02 18:35:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ile413ala,asp436ala' Tue Jun 30 17:28:24 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Ile413Ala;Asp436Ala]' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain pSu9N 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f2 f3 f4 oli-tim50-3 1 Tim50 sPBD 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q02776:p.Glu415Ala mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain E A Wed May 02 15:22:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu415ala' Tue Jun 30 15:47:23 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu415Ala' pSu9N 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f2 f3 f4c oli-tim50-4 1 pSu9N 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Tim50 sPBD 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q02776:p.Leu434Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L N Wed May 02 18:31:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu434asn' Tue Jun 30 15:51:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu434Asn' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f2 f3 f4c oli-tim50-5 1 Tim50 sPBD 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain pSu9N 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P00842:p.[Leu7Gln;Ala12Gln;Ala16_Ala17delinsGlnGln] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain AA QQ certain certain sequence position certain certain certain sequence position certain L Q certain certain sequence position certain certain certain sequence position certain A Q Thu Jul 07 12:06:47 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was leu7gln_ala12gln_ala16gln_ala17gln Fri Jul 22 10:57:03 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu7gln,ala12gln,ala16gln,ala17gln' Wed May 02 19:36:37 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu7gln,ala12gln,ala_ala16-17gln_gln' Tue Jun 30 17:25:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu7Gln;Ala12Gln;Ala16_Ala17delinsGlnGln]' binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f2 f4b tim50-tim50 1 Tim50core 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Tim50 sPBD 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f5