IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ CtpB assembles a gated protease tunnel regulating cell-cell signaling during spore formation in Bacillus subtilis. CtpB assembles a gated protease tunnel regulating cell-cell signaling during spore formation in Bacillus subtilis. Cell (0092-8674) 2013 imex curation Mastny M., Heuck A., Kurzbauer R., Heiduk A., Boisguerin P., Volkmer R., Ehrmann M., Rodrigues C.D., Rudner D.Z., Clausen T. clausen@imp.univie.ac.at 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro protease assay protease assay weight by comassie molecular weight estimation by coomasie staining weight by comassie Mastny M., Heuck A., Kurzbauer R., Heiduk A., Boisguerin P., Volkmer R., Ehrmann M., Rodrigues C.D., Rudner D.Z., Clausen T. I've not captured 1C and 1D as 1c contains a fusion protein and 1D a membrane prep so not sure what else that will have added to the assay. There is also a peptide degradation assay in fig. 4e/f but as its only clear what the final 3 amino acids of the peptide are, I have not added this clausen@imp.univie.ac.at Accepted 2014-FEB-18 by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation CtpB assembles a gated protease tunnel regulating cell-cell signaling during spore formation in Bacillus subtilis. CtpB assembles a gated protease tunnel regulating cell-cell signaling during spore formation in Bacillus subtilis. Cell (0092-8674) 2013 imex curation Mastny M., Heuck A., Kurzbauer R., Heiduk A., Boisguerin P., Volkmer R., Ehrmann M., Rodrigues C.D., Rudner D.Z., Clausen T. clausen@imp.univie.ac.at 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro peptide array peptide array antibody detection identification by antibody antibody detection Mastny M., Heuck A., Kurzbauer R., Heiduk A., Boisguerin P., Volkmer R., Ehrmann M., Rodrigues C.D., Rudner D.Z., Clausen T. clausen@imp.univie.ac.at Accepted 2014-FEB-18 by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation CtpB assembles a gated protease tunnel regulating cell-cell signaling during spore formation in Bacillus subtilis. CtpB assembles a gated protease tunnel regulating cell-cell signaling during spore formation in Bacillus subtilis. Cell (0092-8674) 2013 imex curation Mastny M., Heuck A., Kurzbauer R., Heiduk A., Boisguerin P., Volkmer R., Ehrmann M., Rodrigues C.D., Rudner D.Z., Clausen T. clausen@imp.univie.ac.at 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Mastny M., Heuck A., Kurzbauer R., Heiduk A., Boisguerin P., Volkmer R., Ehrmann M., Rodrigues C.D., Rudner D.Z., Clausen T. clausen@imp.univie.ac.at Accepted 2014-FEB-18 by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation CtpB assembles a gated protease tunnel regulating cell-cell signaling during spore formation in Bacillus subtilis. CtpB assembles a gated protease tunnel regulating cell-cell signaling during spore formation in Bacillus subtilis. Cell (0092-8674) 2013 imex curation Mastny M., Heuck A., Kurzbauer R., Heiduk A., Boisguerin P., Volkmer R., Ehrmann M., Rodrigues C.D., Rudner D.Z., Clausen T. clausen@imp.univie.ac.at 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Mastny M., Heuck A., Kurzbauer R., Heiduk A., Boisguerin P., Volkmer R., Ehrmann M., Rodrigues C.D., Rudner D.Z., Clausen T. clausen@imp.univie.ac.at Accepted 2014-FEB-18 by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation CtpB assembles a gated protease tunnel regulating cell-cell signaling during spore formation in Bacillus subtilis. CtpB assembles a gated protease tunnel regulating cell-cell signaling during spore formation in Bacillus subtilis. Cell (0092-8674) 2013 imex curation Mastny M., Heuck A., Kurzbauer R., Heiduk A., Boisguerin P., Volkmer R., Ehrmann M., Rodrigues C.D., Rudner D.Z., Clausen T. clausen@imp.univie.ac.at 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Mastny M., Heuck A., Kurzbauer R., Heiduk A., Boisguerin P., Volkmer R., Ehrmann M., Rodrigues C.D., Rudner D.Z., Clausen T. clausen@imp.univie.ac.at Accepted 2014-FEB-18 by PPORRAS Cell (0092-8674) 2013 Only protein-protein interactions imex curation fmllrrkaya FMLLRRKAYA peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) FMLLRRKAYA poly alanine peptide peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) sp4fa_bacsu Stage IV sporulation protein FA spoIVFA bofB BSU27980 protein protein bacsu Bacillus subtilis MSHRADEIRKRLEKRRKQLSGSKRFSTQTVSEKQKPPSWVMVTDQEKHGTLPVYEDNMPTFNGKHPLVKTDSIILKCLLSACLVLVSAIAYKTNIGPVSQIKPAVAKTFETEFQFASASHWFETKFGNPLAFLAPEHKNKEQQIEVGKDLIAPASGKVQQDFQDNGEGIKVETSSDKIDSVKEGYVVEVSKDSQTGLTVKVQHADNTYSIYGELKDVDVALYDFVDKGKKLGSIKLDDHNKGVYYFAMKDGDKFIDPIQVISFE 85723346B15932B6 pdz binder NLVLAGLHSYA peptide peptide polypeptide oligopeptide oligopeptide polypeptide chemical synthesis Chemical synthesis (Chemical synthesis) NLVLAGLHSYA sp4b_bacsu SpoIVB peptidase spoIVB Sporulation factor IV B protease Stage IV sporulation protein B BSU24230 protein protein bacsu Bacillus subtilis MPDNIRKAVGLILLVSLLSVGLCKPLKEYLLIPTQMRVFETQTQAIETSLSVNAQTSESSEAFTVKKDPHEIKVTGKKSGESELVYDLAGFPIKKTKVHVLPDLKVIPGGQSIGVKLHSVGVLVVGFHQINTSEGKKSPGETAGIEAGDIIIEMNGQKIEKMNDVAPFIQKAGKTGESLDLLIKRDKQKIKTKLIPEKDEGEGKYRIGLYIRDSAAGIGTMTFYEPKTKKYGALGHVISDMDTKKPIVVENGEIVKSTVTSIEKGTGGNPGEKLARFSSERKTIGDINRNSPFGIFGTLHQPIQNNISDQALPVAFSTEVKKGPAEILTVIDDDKVEKFDIEIVSTTPQKFPATKGMVLKITDPRLLKETGGIVQGMSGSPIIQNGKVIGAVTHVFVNDPTSGYGVHIEWMLSEAGIDIYGKEKAS 8BA00732B9D12271 ctpb_bacsu Carboxy-terminal processing protease CtpB ctpB yvjB BSU35240 protein protein bacsu Bacillus subtilis MNQKIMAVIAAGSMLFGGAGVYAGINLLEMDKPQTAAVPATAQADSERDKAMDKIEKAYELISNEYVEKVDREKLLEGAIQGMLSTLNDPYSVYMDKQTAKQFSDSLDSSFEGIGAEVGMEDGKIIIVSPFKKSPAEKAGLKPNDEIISINGESMAGKDLNHAVLKIRGKKGSSVSMKIQRPGTKKQLSFRIKRAEIPLETVFASEKKVQGHSVGYIAISTFSEHTAEDFAKALRELEKKEIEGLVIDVRGNPGGYLQSVEEILKHFVTKDQPYIQIAERNGDKKRYFSTLTHKKAYPVNVITDKGSASASEILAGALKEAGHYDVVGDTSFGKGTVQQAVPMGDGSNIKLTLYKWLTPNGNWIHKKGIEPTIAIKQPDYFSAGPLQLKEPLKVDMNNEDVKHAQVLLKGLSFDPGREDGYFSKDMKKAVMAFQDQNKLNKTGVIDTRTAETLNQQIEKKKSDEKNDLQLQTALKSLFVN 902B082C85B5CEC4 ctpb-spoivfa 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined extracellular region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain ecoli Escherichia coli (strain K12) 11 enzyme enzyme unspecified role unspecified role region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 17 15 protein cleavage protein cleavage Fig. 1B, Supp. Fig. 1B, 1D O35002 increases degradation at protein level of P26936 spoivb-spoivfa 1 10 enzyme enzyme unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) 8 enzyme target enzyme target substrate substrate unspecified role unspecified role extracellular region sufficient to bind sufficient binding region sufficient to bind range range certain certain sequence position certain region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 1B P26937 increases degradation at protein level of P26936 In vitro reconstituted cleavage reactions demonstrate that 4B-dependent cleavage of 4FA generates a substrate that can be further digested by CtpB. ctpb-1 1 11 putative self putative self putative self putative self region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined O35002:p.Ser309Ala mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain S A Wed May 02 19:20:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser309ala' Tue Jun 30 15:46:45 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser309Ala' region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) protein cleavage protein cleavage true Supp. Fig. 1A ctpb-1 5 11 unspecified role unspecified role neutral component neutral component region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Fig. 1C ctpb-ctpb 4 11 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Table 1 1.9A Rworking = 0.2, Rfree = 0.22 PDBe show this as a heterotrimer with 2 peptide chains but this representation appears to be what is described in the paper. Peptides are given in header file and only contain n 3 and 4 amino acids respectively. ctpb-ctpb-5 4 7 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined chemical synthesis Chemical synthesis (Chemical synthesis) 11 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ser-309 direct binding direct binding region direct binding certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 44 40 direct interaction direct interaction Supp. Fig. 3 Supp. Table 1 2.6A Rworking = 0.23, Rfree = 0.24 3 possible peptides given in header file, from 4-6 amino acids in length so have described as generic poly alanine modelled in Supp Fig. 3 ctpb-ctpb-2 4 11 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range O35002:p.Val209Ala mutation mutation certain certain sequence position certain certain certain sequence position certain V A Wed May 02 17:53:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val209ala' Tue Jun 30 16:29:20 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val209Ala' ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Table 1 1.8A Rworking = 0.18, Rfree = 0.19 ctpb-ctpb-6 4 7 unspecified role unspecified role neutral component neutral component chemical synthesis Chemical synthesis (Chemical synthesis) 11 unspecified role unspecified role neutral component neutral component O35002:p.Arg168Ala mutation mutation certain certain sequence position certain certain certain sequence position certain R A Wed May 02 14:38:11 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg168ala' Tue Jun 30 18:28:46 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg168Ala' c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Table 1 2.4A Rworking = 0.22, Rfree = 0.26 PDBe show this as a heterotrimer with 2 peptide chains but this representation appears to be what is described in the pape and in header file. ctpb-ctpb-4 4 11 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 11 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) 58 61 direct interaction direct interaction Supp. Table 1 1.9A Rworking = 0.2, Rfree = 0.23 ctpb-1 4 11 unspecified role unspecified role neutral component neutral component c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range O35002:p.Val118Tyr mutation mutation certain certain sequence position certain certain certain sequence position certain V Y Wed May 02 19:28:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val118tyr' Tue Jun 30 15:40:32 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val118Tyr' region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Table 1. 1.95A Rworking = 0.2, Rfree = 0.24 pdz_binder-ctpb 2 9 unspecified role unspecified role bait bait chemical synthesis Chemical synthesis (Chemical synthesis) 11 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 4C, Supp. Fig. 4A, 4B Amino acid subsitutions demonstrated that the PDZ domain of CtpB preferentially binds peptides carrying Tyr/Phe/Trp-Ala/Val combinations at their C terminus ctpb-fmllrrkaya-2 3 6 unspecified role unspecified role neutral component neutral component fmllrrkaya:p.Ala10Val mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain A V Wed May 02 18:48:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala10val' Tue Jun 30 17:30:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala10Val' chemical synthesis Chemical synthesis (Chemical synthesis) 11 unspecified role unspecified role neutral component neutral component O35002:p.Ser309Ala mutation mutation certain certain sequence position certain certain certain sequence position certain S A Wed May 02 15:34:31 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser309ala' Tue Jun 30 16:24:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser309Ala' O35002:p.Arg168Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:50:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg168ala' Tue Jun 30 19:51:08 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg168Ala' O35002:p.Val118Tyr mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain V Y Wed May 02 19:21:32 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val118tyr' Tue Jun 30 20:11:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val118Tyr' c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range O35002:p.Arg168Phe mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R F Wed May 02 17:08:29 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg168phe' Tue Jun 30 18:20:35 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg168Phe' ecoli Escherichia coli (strain K12) direct interaction direct interaction Supp. Fig. 4C, 5B The derived dissociation constants (KD) for the full-length CtpB protein were about 3-fold higher than for the isolated PDZ domain ctpb-spoivfa-1 1 8 enzyme target enzyme target substrate substrate unspecified role unspecified role region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined extracellular region sufficient to bind sufficient binding region sufficient to bind range range range range ecoli Escherichia coli (strain K12) 11 enzyme enzyme unspecified role unspecified role region required to bind necessary binding region required to bind range range certain certain sequence position certain certain certain sequence position certain range range c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range O35002:p.Arg168Ala mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain R A Wed May 02 17:18:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg168ala' Tue Jun 30 20:20:39 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg168Ala' O35002:p.[Val118Tyr;Arg168Phe] mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain V Y certain certain sequence position certain certain certain sequence position certain R F Wed May 02 20:31:17 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val118tyr,arg168phe' Tue Jun 30 19:47:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val118Tyr;Arg168Phe]' O35002:p.Gln338Glu mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain Q E Wed May 02 17:10:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln338glu' Tue Jun 30 16:27:17 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln338Glu' O35002:p.[Val118Tyr;Arg168Ala] mutation disrupting rate mutation disrupting interaction rate mutation disrupting rate certain certain sequence position certain certain certain sequence position certain V Y certain certain sequence position certain certain certain sequence position certain R A Wed May 02 15:03:38 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val118tyr,arg168ala' Tue Jun 30 15:44:56 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Val118Tyr;Arg168Ala]' O35002:p.Val118Tyr mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain V Y Wed May 02 17:10:18 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val118tyr' Tue Jun 30 19:30:02 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val118Tyr' O35002:p.Arg168Phe mutation decreasing rate mutation decreasing interaction rate mutation decreasing rate certain certain sequence position certain certain certain sequence position certain R F Wed May 02 17:42:50 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg168phe' Tue Jun 30 20:03:41 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg168Phe' ecoli Escherichia coli (strain K12) protein cleavage protein cleavage Fig. 5C, Sequence length of spoIVFA inferred from information in Fig. 1C. ctpb-fmllrrkaya-3 3 11 unspecified role unspecified role neutral component neutral component region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range ecoli Escherichia coli (strain K12) 6 unspecified role unspecified role neutral component neutral component fmllrrkaya:p.Ala10Val mutation increasing strength mutation increasing interaction strength mutation increasing strength certain certain sequence position certain certain certain sequence position certain A V Wed May 02 16:51:42 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ala10val' Tue Jun 30 15:38:05 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ala10Val' chemical synthesis Chemical synthesis (Chemical synthesis) direct interaction direct interaction Supp. Fig. 4C The derived dissociation constants (KD) for the full-length CtpB protein were about 3-fold higher than for the isolated PDZ domain