MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Interaction with both ZNRF3 and LGR4 is required for the signalling activity of R-spondin. Interaction with both ZNRF3 and LGR4 is required for the signalling activity of R-spondin. EMBO Rep. (1469-221X) 2013 imex curation Xie Y., Zamponi R., Charlat O., Ramones M., Swalley S., Jiang X., Rivera D., Tschantz W., Lu B., Quinn L., Dimitri C., Parker J., Jeffery D., Wilcox S.K., Watrobka M., LeMotte P., Granda B., Porter J.A., Myer V.E., Loew A., Cong F. feng.cong@novartis.com 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Xie Y., Zamponi R., Charlat O., Ramones M., Swalley S., Jiang X., Rivera D., Tschantz W., Lu B., Quinn L., Dimitri C., Parker J., Jeffery D., Wilcox S.K., Watrobka M., LeMotte P., Granda B., Porter J.A., Myer V.E., Loew A., Cong F. feng.cong@novartis.com Accepted 2015-FEB-09 by LUANA EMBO Rep. (1469-221X) 2013 Only protein-protein interactions imex curation rspo1_human R-spondin-1 RSPO1 Roof plate-specific spondin-1 protein protein human Homo sapiens Human MRLGLCVVALVLSWTHLTISSRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA DIP protein Q2MKA7 original sequence version: 69 DIP protein Q2MKA7 original sequence version: 56 43794A881B1C0278 znrf3_human E3 ubiquitin-protein ligase ZNRF3 RING finger protein 203 ZNRF3 KIAA1133 RNF203 Zinc/RING finger protein 3 RING-type E3 ubiquitin transferase ZNRF3 protein protein human Homo sapiens Human MRPRSGGRPGATGRRRRRLRRRPRGLRCSRLPPPPPLPLLLGLLLAAAGPGAARAKETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDMGIFLAFFVVVSLVCLILLVKIKLKQRRSQNSMNRLAVQALEKMETRKFNSKSKGRREGSCGALDTLSSSSTSDCAICLEKYIDGEELRVIPCTHRFHRKCVDPWLLQHHTCPHCRHNIIEQKGNPSAVCVETSNLSRGRQQRVTLPVHYPGRVHRTNAIPAYPTRTSMDSHGNPVTLLTMDRHGEQSLYSPQTPAYIRSYPPLHLDHSLAAHRCGLEHRAYSPAHPFRRPKLSGRSFSKAACFSQYETMYQHYYFQGLSYPEQEGQSPPSLAPRGPARAFPPSGSGSLLFPTVVHVAPPSHLESGSTSSFSCYHGHRSVCSGYLADCPGSDSSSSSSSGQCHCSSSDSVVDCTEVSNQGVYGSCSTFRSSLSSDYDPFIYRSRSPCRASEAGGSGSSGRGPALCFEGSPPPEELPAVHSHGAGRGEPWPGPASPSGDQVSTCSLEMNYSSNSSLEHRGPNSSTSEVGLEASPGAAPDLRRTWKGGHELPSCACCCEPQPSPAGPSAGAAGSSTLFLGPHLYEGSGPAGGEPQSGSSQGLYGLHPDHLPRTDGVKYEGLPCCFYEEKQVARGGGGGSGCYTEDYSVSVQYTLTEEPPPGCYPGARDLSQRIPIIPEDVDCDLGLPSDCQGTHSLGSWGGTRGPDTPRPHRGLGATREEERALCCQARALLRPGCPPEEAGAVRANFPSALQDTQESSTTATEAAGPRSHSADSSSPGA DIP protein Q9ULT6 original sequence version: 76 EE68B810BD3C9C74 znrf3-rspo1 1 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified direct interaction direct interaction f2a znrf3-rspo1-1 1 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified Q2MKA7:p.Arg66Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain R A Wed May 02 16:59:28 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'arg66ala' Tue Jun 30 19:30:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Arg66Ala' 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain direct interaction direct interaction f2b znrf3-rspo1-2 1 2 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified 3 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q9ULT6:p.Pro103Ala mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain P A Wed May 02 17:08:30 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'pro103ala' Tue Jun 30 18:34:51 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Pro103Ala' direct interaction direct interaction f2c