IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ The human minor histocompatibility antigen 1 is a RhoGAP. The human minor histocompatibility antigen 1 is a RhoGAP. PLoS ONE 2013 imex curation de Kreuk B.J., Schaefer A., Anthony E.C., Tol S., Fernandez-Borja M., Geerts D., Pool J., Hambach L., Goulmy E., Hordijk P.L. IBD - Inflammatory bowel disease Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Supplementary Figures S2 and S3 seem to have been mislabeled: Fig. S2 shows GST pulldown assays described in the text as Fig. S3, while Fig. S3 shows immunostaining images described in the text as Fig. S2. Fig. 8c and 8d show the results of an in vitro GTPase assay, indicating that HMHA1 has in vitro GAP activity towards Rac1, Cdc42 and RhoA but not Ras; however it was not possible to establish the origin of the proteins used in these experiments and authors did not reply to a request for clarification, hence these interactions are not captured here. p.hordijk@sanquin.nl 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry de Kreuk B.J., Schaefer A., Anthony E.C., Tol S., Fernandez-Borja M., Geerts D., Pool J., Hambach L., Goulmy E., Hordijk P.L. IBD - Inflammatory bowel disease Supplementary Figures S2 and S3 seem to have been mislabeled: Fig. S2 shows GST pulldown assays described in the text as Fig. S3, while Fig. S3 shows immunostaining images described in the text as Fig. S2. Although not explicitely mentioned in the materials and methods section, the origin of HMHA1 was derived from the title and the protein architecture drawing in Fig. 1A (only the human HMHA1 protein has 1136 amino acid residues). p.hordijk@sanquin.nl Accepted 2015-FEB-10 by MGT PLoS ONE 2013 Only protein-protein interactions imex curation The human minor histocompatibility antigen 1 is a RhoGAP. The human minor histocompatibility antigen 1 is a RhoGAP. PLoS ONE 2013 imex curation de Kreuk B.J., Schaefer A., Anthony E.C., Tol S., Fernandez-Borja M., Geerts D., Pool J., Hambach L., Goulmy E., Hordijk P.L. IBD - Inflammatory bowel disease Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Supplementary Figures S2 and S3 seem to have been mislabeled: Fig. S2 shows GST pulldown assays described in the text as Fig. S3, while Fig. S3 shows immunostaining images described in the text as Fig. S2. Fig. 8c and 8d show the results of an in vitro GTPase assay, indicating that HMHA1 has in vitro GAP activity towards Rac1, Cdc42 and RhoA but not Ras; however it was not possible to establish the origin of the proteins used in these experiments and authors did not reply to a request for clarification, hence these interactions are not captured here. p.hordijk@sanquin.nl 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot de Kreuk B.J., Schaefer A., Anthony E.C., Tol S., Fernandez-Borja M., Geerts D., Pool J., Hambach L., Goulmy E., Hordijk P.L. IBD - Inflammatory bowel disease Supplementary Figures S2 and S3 seem to have been mislabeled: Fig. S2 shows GST pulldown assays described in the text as Fig. S3, while Fig. S3 shows immunostaining images described in the text as Fig. S2. This experiment is described in more detail in PMID:21693584 and PMID:16492808. The GST-tagged Rac1 construct is described in PMID:21693584 and PMID:14675773. p.hordijk@sanquin.nl Accepted 2015-FEB-10 by MGT PLoS ONE 2013 Only protein-protein interactions imex curation The human minor histocompatibility antigen 1 is a RhoGAP. The human minor histocompatibility antigen 1 is a RhoGAP. PLoS ONE 2013 imex curation de Kreuk B.J., Schaefer A., Anthony E.C., Tol S., Fernandez-Borja M., Geerts D., Pool J., Hambach L., Goulmy E., Hordijk P.L. IBD - Inflammatory bowel disease Crohn's disease - Interactions of proteins identified as having a link to Crohn's disease Supplementary Figures S2 and S3 seem to have been mislabeled: Fig. S2 shows GST pulldown assays described in the text as Fig. S3, while Fig. S3 shows immunostaining images described in the text as Fig. S2. Fig. 8c and 8d show the results of an in vitro GTPase assay, indicating that HMHA1 has in vitro GAP activity towards Rac1, Cdc42 and RhoA but not Ras; however it was not possible to establish the origin of the proteins used in these experiments and authors did not reply to a request for clarification, hence these interactions are not captured here. p.hordijk@sanquin.nl 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-jurkat Homo sapiens jurkat Human T cell leukemia facs fluorescence-activated cell sorting FACS Flow cytometry facs antibody detection identification by antibody antibody detection de Kreuk B.J., Schaefer A., Anthony E.C., Tol S., Fernandez-Borja M., Geerts D., Pool J., Hambach L., Goulmy E., Hordijk P.L. IBD - Inflammatory bowel disease Supplementary Figures S2 and S3 seem to have been mislabeled: Fig. S2 shows GST pulldown assays described in the text as Fig. S3, while Fig. S3 shows immunostaining images described in the text as Fig. S2. p.hordijk@sanquin.nl Accepted 2015-FEB-10 by MGT PLoS ONE 2013 Only protein-protein interactions imex curation hmha1_human Rho GTPase-activating protein 45 ARHGAP45 HMHA1 KIAA0223 protein protein human Homo sapiens Human MFSRKKRELMKTPSISKKNRAGSPSPQPSGELPRKDGADAVFPGPSLEPPAGSSGVKATGTLKRPTSLSRHASAAGFPLSGAASWTLGRSHRSPLTAASPGELPTEGAGPDVVEDISHLLADVARFAEGLEKLKECVLRDDLLEARRPRAHECLGEALRVMHQIISKYPLLNTVETLTAAGTLIAKVKAFHYESNNDLEKQEFEKALETIAVAFSSTVSEFLMGEVDSSTLLAVPPGDSSQSMESLYGPGSEGTPPSLEDCDAGCLPAEEVDVLLQRCEGGVDAALLYAKNMAKYMKDLISYLEKRTTLEMEFAKGLQKIAHNCRQSVMQEPHMPLLSIYSLALEQDLEFGHSMVQAVGTLQTQTFMQPLTLRRLEHEKRRKEIKEAWHRAQRKLQEAESNLRKAKQGYVQRCEDHDKARFLVAKAEEEQAGSAPGAGSTATKTLDKRRRLEEEAKNKAEEAMATYRTCVADAKTQKQELEDTKVTALRQIQEVIRQSDQTIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQYASHVRQLQRDQEPDVHYDFEPHVSANAWSPVMRARKSSFNVSDVARPEAAGSPPEEGGCTEGTPAKDHRAGRGHQVHKSWPLSISDSDSGLDPGPGAGDFKKFERTSSSGTMSSTEELVDPDGGAGASAFEQADLNGMTPELPVAVPSGPFRHEGLSKAARTHRLRKLRTPAKCRECNSYVYFQGAECEECCLACHKKCLETLAIQCGHKKLQGRLQLFGQDFSHAARSAPDGVPFIVKKCVCEIERRALRTKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQLPEPLISFRLYHELVGLAKDSLKAEAEAKAASRGRQDGSESEAVAVALAGRLRELLRDLPPENRASLQYLLRHLRRIVEVEQDNKMTPGNLGIVFGPTLLRPRPTEATVSLSSLVDYPHQARVIETLIVHYGLVFEEEPEETPGGQDESSNQRAEVVVQVPYLEAGEAVVYPLQEAAADGCRESRVVSNDSDSDLEEASELLSSSEASALGHLSFLEQQQSEASLEVASGSHSGSEEQLEATAREDGDGDEDGPAQQLSGFNTNQSNNVLQAPLPPMRLRGGRMTLGSCRERQPEFV 9536787B3B1EE16D cdc42_human Cell division control protein 42 homolog CDC42 G25K GTP-binding protein protein protein human Homo sapiens Human MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL 51A437E22A4D8FFF rhoa_human Transforming protein RhoA Rho cDNA clone 12 ARHA RHO12 RHOA ARH12 protein protein human Homo sapiens Human MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCLVL DIP protein P61586 original sequence version: 86 DIP protein P61586 original sequence version: 123 DIP protein P61586 original sequence version: 57 DIP protein P61586 original sequence version: 88 DIP protein P61586 original sequence version: 87 DIP protein P61586 original sequence version: 85 DIP protein P61586 original sequence version: 125 DIP protein P61586 original sequence version: 132 C4DA2DC31FF858BC rac1_human Ras-related C3 botulinum toxin substrate 1 RAC1 MIG5 p21-Rac1 Ras-like protein TC25 Cell migration-inducing gene 5 protein TC25 protein protein human Homo sapiens Human MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL ACEDF83A45E5EA67 hmha1-rac1 1 7 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 5a cdc42-hmha1 1 5 unspecified role unspecified role neutral component neutral component n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P60953:p.Gly12Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 20:05:05 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly12val' Tue Jun 30 18:24:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly12Val' constitutively active Cdc42 mutant 4 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined colocalization colocalization Fig. 5c hmha1-rhoa 1 4 unspecified role unspecified role neutral component neutral component region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range P61586:p.Gly14Val mutation mutation certain certain sequence position certain certain certain sequence position certain G V Wed May 02 20:29:08 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gly14val' Tue Jun 30 18:59:34 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gly14Val' constitutively active RhoA mutant colocalization colocalization Fig. 5d hmha1-rac1-2 3 7 unspecified role unspecified role neutral component neutral component 4 unspecified role unspecified role neutral component neutral component physical association physical association Fig. 6, Suppl. Fig. S2 (3) CXCL12 (100 ng/ml), a chemokine rac1-hmha1 2 4 unspecified role unspecified role prey prey rhogap_dom sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain ecobb Escherichia coli (strain B / BL21) 7 unspecified role unspecified role bait bait n-terminus gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain undetermined undetermined sequence position undetermined GST-Rac1 construct that lacks the "C-terminal hypervariable domain" ecobb Escherichia coli (strain B / BL21) direct interaction direct interaction Suppl. Fig. 3 (2) More HMHA1 is pulled down by Rac1 loaded with GppNHp, a non-hydrolyzable GTP analog, compared to GDP-loaded Rac1, indicating that HMHA1 preferably binds the active conformation of Rac1. Q92619 decreases activity of P63000