MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it Defective immune responses in mice lacking LUBAC-mediated linear ubiquitination in B cells. Defective immune responses in mice lacking LUBAC-mediated linear ubiquitination in B cells. EMBO J. (0261-4189) 2013 imex curation Sasaki Y., Sano S., Nakahara M., Murata S., Kometani K., Aiba Y., Sakamoto S., Watanabe Y., Tanaka K., Kurosaki T., Iwai K. yoshisasaki@mcp.med.kyoto-u.ac.jp 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions mouse-b-cell Mus musculus B-cell b-cell B-cell [B lymphocyte; B-lymphocyte; B cell; B-cells] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sasaki Y., Sano S., Nakahara M., Murata S., Kometani K., Aiba Y., Sakamoto S., Watanabe Y., Tanaka K., Kurosaki T., Iwai K. yoshisasaki@mcp.med.kyoto-u.ac.jp Accepted 2015-FEB-09 by LUANA EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation Defective immune responses in mice lacking LUBAC-mediated linear ubiquitination in B cells. Defective immune responses in mice lacking LUBAC-mediated linear ubiquitination in B cells. EMBO J. (0261-4189) 2013 imex curation Sasaki Y., Sano S., Nakahara M., Murata S., Kometani K., Aiba Y., Sakamoto S., Watanabe Y., Tanaka K., Kurosaki T., Iwai K. yoshisasaki@mcp.med.kyoto-u.ac.jp 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column western blot western blot Immuno blot Immuno blot Sasaki Y., Sano S., Nakahara M., Murata S., Kometani K., Aiba Y., Sakamoto S., Watanabe Y., Tanaka K., Kurosaki T., Iwai K. yoshisasaki@mcp.med.kyoto-u.ac.jp Accepted 2015-FEB-09 by LUANA EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation shrpn_mouse Sharpin Shank-associated RH domain-interacting protein Shank-interacting protein-like 1 Sharpin Sipl1 Cpdm protein protein mouse Mus musculus Mouse MSPPAGGAAVAADPASPVVLLAVHAAVRPLGAGQDAEAQPRKLQLIADPERPGRFRLGLLGTEPGAVSLEWPLEAICYTVRGPNQHELQPPPGGPGTFSVHFLDPEEAQQWAALVRDATAEGQNGSGSPAPAPAPAMCPISPPCSSMAQIPKATQPEVDLPQSSGNFKKEELATRLSQAIAGGDEKAAAQVAAVLAQHHVALNVQLMEAWFPPGPIRLQVTVEDATSVLSSSSSAHVSLKIHPHCSIAALQDQVFSEFGFPPAVQRWVIGRCLCMPERSLASYGVSQDGDPAFLYLLSAPREVSGQSLQNSKMDRKLGLFPQSLGLPHDLQPSSSSLPSPSQPGWSCPSCTFINASNRPGCEMCSTQRPCAWDPLAAAST DIP protein Q91WA6 original sequence version: 63 C7E4B8F40F6D8F05 rnf31_mouse E3 ubiquitin-protein ligase RNF31 HOIL-1-interacting protein Rnf31 Paul Putative Ariadne-like ubiquitin ligase RING finger protein 31 RING-type E3 ubiquitin transferase RNF31 protein protein mouse Mus musculus Mouse MPGDEERGFLAAREELASALRWDSAQVFPLEQLMPLLATSLPPAARYLQLDAGRLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRSVKFNNPVFRSTVDAVQGGRDVLRLYGYTEERPDGLSFPEGQEEPDEYQVAVVTLEVLLLRTELSLLLQNTHPRQNALDQLLRESVEDGMLQLSEFHPLLREIVPGPRPSAQGSTPGPCFLCGSAPGTLHCPACNQVSCPACDILFHGHPSRAHHLRQALPGSHQTASLSSSLPASSQPRPPSSSLALGDSSLSSPDPANACLPWHCLTCATLNEPWAVFCAVCSQPKGCKVPGIEGSHGTGGLEPEPARDQWACQSCTFENEAAAVLCAICERPRLAQPPSLVVDSHDAGVCQQSLKQEDPLLTAAQPQVWYCDHCTFCNSGPVWVCAMCNRTRDPIPTQPALQSYPSSLEKGRPKPGSSQHLGSSLPASCGDPEKQRQDKMRKEGLQLVSMIQEGETAGASPEEVFSALQYSGTEVPLQWLRSELSYVLEMVAELAGQQDPELGAFSCQEARKAWLDRHGNLDEAVEECVRARRRKVHELQSLGFGPKEGSLQALFQHGGDVARALTELQRQRLEPFHQRLWDRDPEPTPCWDGLDRQSLVRRLLAVYTLPSWGRAELALALLQETPRNYELLDVVEAVRHSQDRAFLRRLLAQECAVCGWALPRNRMQALISCECTICPECFRQHFTIALKEKHITDMVCPACGRPDLTDDAQLLSYFSTLDIQLRESLDPDAYALFHKKLTEAVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCHQTFCVRCKRQWEEQHRGRSCEDFQNWKRTNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGCYNAFYAKNKCPDPNCKVKKSLHGHHPRDCLFYLRDWTAARLQKLLQDNNVMFNTEPPAGTRAVPGGGCRVMEQKEVHSGFRDEACGKETPPGYAGLCQAHYKEYLVSLINAHSLDPATLYEVEELETATIRYLHLAPQPADGEDLPAYQARLLQKLREEVPLGQSIARRRK DIP protein Q924T7 original sequence version: 69 DIP protein Q924T7 original sequence version: 113 C630572B8BDFC0AD hoil1_mouse RanBP-type and C3HC4-type zinc finger-containing protein 1 Rbck1 Rbck Ubce7ip3 Uip28 Heme-oxidized IRP2 ubiquitin ligase 1 homolog UbcM4-interacting protein 28 Ubiquitin-conjugating enzyme 7-interacting protein 3 RING-type E3 ubiquitin transferase HOIL-1 protein protein mouse Mus musculus Mouse MDEKTKKAEEMALSLARAVAGGDEQAAIKYATWLAEQRVPLRVQVKPEVSPTQDIRLCVSVEDAYMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPSLQQWVVGQRLARDQETLHSHGIRRNGDGAYLYLLSARNTSLNPQELQRQRQLRMLEDLGFKDLTLQSRGPLEPVLPKPRTNQEPGQPDAAPESPPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLEQRSLVLNTEPTECPVCYSVLAPGEAVVLRECLHTFCRECLQGTIRNSQEAEVACPFIDSTYSCPGKLLEREIRALLSPEDYQRFLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEHMNCREYQDDLALRAQNDVAARQTTEMLKVMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH DIP protein Q9WUB0 original sequence version: 83 CBD3B40CD4E55180 sharpin-rbck1-1 1 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 3 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey living cell living cell physiological level physiological level endogenous level endogenous endogenous endogenous level association association f1c rbck1-rnf31-14 2 4 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed cell lysate cell lysate range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 5 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level 3 western blot western blot Immuno blot Immuno blot western blot western blot Immuno blot Immuno blot unspecified role unspecified role neutral component neutral component cell lysate cell lysate physiological level physiological level endogenous level endogenous endogenous endogenous level association association f1d