MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors. A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors. EMBO J. (0261-4189) 2013 imex curation Malvezzi F., Litos G., Schleiffer A., Heuck A., Mechtler K., Clausen T., Westermann S. westermann@imp.ac.at 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro itc isothermal titration calorimetry ITC ITC itc predetermined predetermined participant predetermined Malvezzi F., Litos G., Schleiffer A., Heuck A., Mechtler K., Clausen T., Westermann S. His-tagged Spc24-25 full length and globular domain, N-terminal 6XHis-tagged Cnn1ΔHFD and Cnn1ΔHFDΔBC have been used in the experiments. westermann@imp.ac.at Accepted 2014-FEB-19 by MARTA EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors. A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors. EMBO J. (0261-4189) 2013 imex curation Malvezzi F., Litos G., Schleiffer A., Heuck A., Mechtler K., Clausen T., Westermann S. westermann@imp.ac.at 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Malvezzi F., Litos G., Schleiffer A., Heuck A., Mechtler K., Clausen T., Westermann S. His-tagged Spc24-25 full length and globular domain, have been used in the experiments. westermann@imp.ac.at Accepted 2014-FEB-19 by MARTA EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors. A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors. EMBO J. (0261-4189) 2013 imex curation Malvezzi F., Litos G., Schleiffer A., Heuck A., Mechtler K., Clausen T., Westermann S. westermann@imp.ac.at 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Malvezzi F., Litos G., Schleiffer A., Heuck A., Mechtler K., Clausen T., Westermann S. westermann@imp.ac.at Accepted 2014-FEB-19 by MARTA EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors. A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors. EMBO J. (0261-4189) 2013 imex curation Malvezzi F., Litos G., Schleiffer A., Heuck A., Mechtler K., Clausen T., Westermann S. westermann@imp.ac.at 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Malvezzi F., Litos G., Schleiffer A., Heuck A., Mechtler K., Clausen T., Westermann S. His-tagged Spc24-25 full length and globular domain have been used in the experiments. westermann@imp.ac.at Accepted 2014-FEB-19 by MARTA EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors. A structural basis for kinetochore recruitment of the Ndc80 complex via two distinct centromere receptors. EMBO J. (0261-4189) 2013 imex curation Malvezzi F., Litos G., Schleiffer A., Heuck A., Mechtler K., Clausen T., Westermann S. westermann@imp.ac.at 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column weight by comassie molecular weight estimation by coomasie staining weight by comassie Malvezzi F., Litos G., Schleiffer A., Heuck A., Mechtler K., Clausen T., Westermann S. His-tagged Spc24-25 full length and globular domain, N-terminal 6XHis-tagged Cnn1ΔHFD and Cnn1ΔHFDΔBC and 6xHis-Ndc80-Nuf2 have been used in the experiments. westermann@imp.ac.at Accepted 2014-FEB-19 by MARTA EMBO J. (0261-4189) 2013 Only protein-protein interactions imex curation dsn1_yeast Kinetochore-associated protein DSN1 YIB10W YIR010W DSN1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSLEPTQTVSGTPPMLHQRTHKQVYPLRMETIPILESDSKATLQSNEPTQKDEEETEYFENKQSVSNLSPDLKFKRHKNKHIQGFPTLGERLDNLQDIKKAKRVENFNSSAPIADDNHSGDATANATANATANATANVNASAMPAPYMPYYYYYHPMNAPTPAMIPYPGSPMHSIMPNSSLQPFYSQPTAAGGPDMTTPQNISSSQQLLPAPQLFPYGSFHQQQLQQPHYIQRTRERKKSIGSQRGRRLSMLASQANGGSTIISPHKDIPEEDFYTVVGNASFGKNLQIRQLFNWCLMRSLHKLELKAKNQEEEGELEHLTKKSKLESTKAETDYVDPKRLAMVIIKEFVDDLKKDHIAIDWEDEEKYEDEDEEKILDNTENYDDTELRQLFQENDDDDDDDDEVDYSEIQRSRRKFSERRKALPKEPKKLLPNSKNVENTKNLSILTSKVNAIKNEVKEWAVTLDTSRPDLEWQELTSFSSQPLEPLSDTEEPDLAIADVETKLETKVDELRYQSHILNSHSLALNEITNSKVNKLNIETMRKISSETDDDHSQVINPQQLLKGLSLSFSKKLDL F859D3547378C072 nnf1_yeast Kinetochore-associated protein NNF1 J2011 YJR112W NNF1 protein protein yeast Saccharomyces cerevisiae Baker's yeast MVNSHGIRYIRLKQVFNRALDQSISKLQSWDKVSSCFPQYVNSKQGAINVANCQRQLTEFWTELCQREFKEIMEERNVEQKLNELDELILEAKERYTDRDQDEVNKGPAIDELSSKELVECHLYSQRMHAIHEIDERLAKVNEMNDQLAQELKDLETQVEVEKNEIGKMYDEYLGSHTDQPANVLLVQSLNDMVLELKENY 53568A8E6EA95694 nuf2_yeast Kinetochore protein NUF2 YOL069W NUF2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSRNQDVFPILDLQELVICLQSCDFALATQENISRPTSDYMVTLYKQIIENFMGISVESLLNSSNQETGDGHLQEENENIYLDTLNVLVLNKICFKFFENIGVQDFNMTDLYKPEAQRTQRLLSAVVNYARFREERMFDCNSFILQMESLLGQLRSKFDDYNLIQQQLKQYEDVDGDNIPDEQELQKLEEQNKELEIQLKKLTKIQETLSIDYNDYKISKQSIFKDLEALSFQIVELESNRDKLIKISNTDMEELSEGIKELNDLLIQRKKTLDDLTAQQKNLQDTVTTFETIISELYDVLRIISSEVQESNRTETELVGLKQNLINNKLKLMNVLETGIMYKLEILQEQLDLQLKNLEKLSQDTKEESRLNDTKLMDLQIKYENEIKPKIDKTDIFIQEELISGKINKLNDEIKQLQKDFEVEVKEIEIEYSLLSGHINKYMNEMLEYMQ D58796E1B5D1E772 spc24_yeast Kinetochore protein SPC24 SPC24 YM9718.16C YMR117C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQKDNLLDNPVEFLKEVRESFDIQQDVDAMKRIRHDLDVIKEESEARISKEHSKVSESNKKLNAERINVAKLEGDLEYTNEESNEFGSKDELVKLLKDLDGLERNIVSLRSELDEKMKLYLKDSEIISTPNGSKIKAKVIEPELEEQSAVTPEANENILKLKLYRSLGVILDLENDQVLINRKNDGNIDILPLDNNLSDFYKTKYIWERLGK 8BE4B8619DD4C8FB 8BE4B8619DD4C8FB mtw1_yeast Kinetochore-associated protein MTW1 MTW1 YAL034W-A YAL034AW DSN3 NSL2 Mis12-like protein protein protein yeast Saccharomyces cerevisiae Baker's yeast MSAPTMRSTSILTEHLGYPPISLVDDIINAVNEIMYKCTAAMEKYLLSKSKIGEEDYGEEIKSGVAKLESLLENSVDKNFDKLELYVLRNVLRIPEEYLDANVFRLENQKDLVIVDENELKKSEEKLREKVNDVELAFKKNEMLLKRVTKVKRLLFTIRGFKQKLNELLKCKDDVQLQKILESLKPIDDTMTLLTDSLRKLYVDSESTSSTEEVEALLQRLKTNGKQNNKDFRTRYIDIRTNNVLRKLGLLGDKEDEKQSAKPDARTQAGDIVSIDIEEPQLDLLDDVL D6F94C290106082B ndc80_yeast Kinetochore protein NDC80 NDC80 80 kDa spindle component protein HEC1 Nuclear division cycle protein 80 TID3 Two-hybrid interaction with DMC1 protein 3 YIL144W protein protein yeast Saccharomyces cerevisiae Baker's yeast MQSSTSTDQHVLHHMDPHRFTSQIPTATSSQLRRRNSTNQGLTDMINKSIARNTISGTGIPTGGINKNKRTRSTVAGGTNGTALALNDKSNSRNSVSRLSINQLGSLQQHLSNRDPRPLRDKNFQSAIQEEIYDYLKKNKFDIETNHPISIKFLKQPTQKGFIIIFKWLYLRLDPGYGFTKSIENEIYQILKNLRYPFLESINKSQISAVGGSNWHKFLGMLHWMVRTNIKLDMCLNKVDRSLINQNTQEITILSQPLKTLDEQDQRQERYELMVEKLLIDYFTESYKSFLKLEDNYEPSMQELKLGFEKFVHIINTDIANLQTQNDNLYEKYQEVMKISQKIKTTREKWKALKSDSNKYENYVNAMKQKSQEWPGKLEKMKSECELKEEEIKALQSNISELHKILRKKGISTEQFELQNQEREKLTRELDKINIQSDKLTSSIKSRKLEAEGIFKSLLDTLRQYDSSIQNLTRSRSQLGHNVNDSSLKINISENLLDRDFHEGISYEQLFPKGSGINESIKKSILKLNDEIQERIKTIEKDNITLEKDIKNLKHDINEKTQINEKLELELSEANSKFELSKQENERLLVAQRIEIEKMEKKINDSNLLMKTKISDAEELVTSTELKLEELKVDLNRKRYKLHQQVIHVIDITSKFKINIQSSLENSENELGNVIEELRNLEFETEHNVTN 7DBC492227A80093 7DBC492227A80093 cenpt_yeast Inner kinetochore subunit CNN1 CNN1 Co-purified with NNF1 protein 1 CENP-T homolog Constitutive centromere-associated network protein CNN1 YFR046C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSTPRKAAGNNENTEVSEIRTPFRERALEEQRLKDEVLIRNTPGYRKLLSASTKSHDILNKDPNEVRSFLQDLSQVLARKSQGNDTTTNKTQARNLIDELAYEESQPEENELLRSRSEKLTDNNIGNETQPDYTSLSQTVFAKLQERDKGLKSRKIDPIIIQDVPTTGHEDELTVHSPDKANSISMEVLRTSPSIGMDQVDEPPVRDPVPISITQQEEPLSEDLPSDDKEETEEAENEDYSFENTSDENLDDIGNDPIRLNVPAVRRSSIKPLQIMDLKHLTRQFLNENRIILPKQTWSTIQEESLNIMDFLKQKIGTLQKQELVDSFIDMGIINNVDDMFELAHELLPLELQSRIESYLF 48CEEC087A056D42 48CEEC087A056D42 nsl1_yeast Kinetochore-associated protein NSL1 NSL1 YPL233W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSQGQSKKLDVTVEQLRSIYHQFHDILEEKTDLHLPKKEYDDDAVRREVQIQLQEFLLSAMTMASKSLEVVNADTVGKTVKQLIMESQEKYMEPFDLDLNEQVRKMYQEWEDETVKVAQLRQTGPAKINEVYNNSKDEYLAQLDGRIGVLQARMMQQQSADHDDSTDDADDHINWEHIKQDYVASLNELYQTQQDLPKVRYNVEKVKRLMDFLEED BE627C405B4831A5 spc25_yeast Kinetochore protein SPC25 YER018C SPC25 protein protein yeast Saccharomyces cerevisiae Baker's yeast MASIDAFSDLERRMDGFQKDVAQVLARQQNHARQQLQQFQAEMRQLHNQHQHLIDELQRLATQRTALQQQIHAAQQATNTTREQWRSYHERESELSRRQSTLAAQSRELDSLLQQRGKECVQLRARWAAQSGNDAAEVALYERLLQLRVLPGASDVHDVRFVFGDDSRCWIEVAMHGDHVIGNSHPALDPKSRATLEHVLTVQGDLAAFLVVARDMLLASL 1BED6CCFF330A5D8 1BED6CCFF330A5D8 cnn1-spc24 1 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P40014:p.Val159Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain V D Wed May 02 14:38:24 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val159asp' Tue Jun 30 16:24:11 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val159Asp' 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f1b f3c cnn1-spc24-1 2 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f1c f1d f2a t1 cnn1-spc24-2 1 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain Q04477:p.Leu160Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L D Wed May 02 17:33:13 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu160asp' Tue Jun 30 17:30:36 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu160Asp' 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f1b f3c cnn1-spc24-3 4 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3b cnn1-spc24-4 5 12 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 14 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified P40014:p.Val159Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain V D Wed May 02 14:29:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val159asp' Tue Jun 30 19:50:28 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val159Asp' range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f3d cnn1-spc24-6 1 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P43618:p.[Phe69Asp;Leu70Asp;Leu73Asp] mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L D certain certain sequence position certain certain certain sequence position certain F D certain certain sequence position certain certain certain sequence position certain L D Fri Jul 22 11:08:58 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'leu70asp,phe69asp,leu73asp' Wed May 02 16:18:27 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe69asp,leu70asp,leu73asp' Tue Jun 30 16:15:12 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Phe69Asp;Leu70Asp;Leu73Asp]' 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association sf3b cnn1-spc24-7 1 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P43618:p.Phe69Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain F D Wed May 02 15:37:25 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'phe69asp' Tue Jun 30 15:46:13 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Phe69Asp' range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association sf3b cnn1-spc24-8 1 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain P43618:p.Leu70Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L D Wed May 02 15:02:15 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu70asp' Tue Jun 30 15:51:52 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu70Asp' physical association physical association sf3b cnn1-spc24-9 1 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P43618:p.Leu73Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L D Wed May 02 14:28:21 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu73asp' Tue Jun 30 16:38:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu73Asp' range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association sf3b cnn1-spc24-10 1 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f5c cnn1-spc24-11 1 14 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 12 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 9 predetermined predetermined participant predetermined predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain physical association physical association f5c dsn1-mtw1-8 5 14 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified P40014:p.Val159Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain V D Wed May 02 15:15:35 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val159asp' Tue Jun 30 17:16:03 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val159Asp' 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain 10 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined association association f4b For this purpose, we used a version of the Mtw1 complex harbouring a deletion of the first 171 amino acids of Dsn1 (Dsn1DN); this deletant is functional in vivo and less prone to degradation in solution (Hornung et al, 2011). Confirming our hypothesis, the Ndc8025V159D complex failed to form a 1:1 interaction with the Mtw1Dsn1DN complex when mixed in equimolar concentrations (Figure 4B). The same result was observed for the Ndc8024L160D complex (Supplementary Figure S4), dsn1-mtw1-9 5 10 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified 14 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified P40014:p.Val159Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain V D Wed May 02 15:29:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val159asp' Tue Jun 30 15:35:09 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val159Asp' 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified association association f4d Strikingly, the deletion of the 29 terminal residues of Dsn1, although not compromising Mtw1 complex assembly, completely disrupted the binding to the Ndc80 complex (Figure 4D). dsn1-mtw1-10 5 10 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified 11 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified 8 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified 14 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q04477:p.Leu160Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain L D Wed May 02 20:29:16 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu160asp' Tue Jun 30 17:05:42 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Leu160Asp' 6 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 13 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified association association sf4b For this purpose, we used a version of the Mtw1 complex harbouring a deletion of the first 171 amino acids of Dsn1 (Dsn1DN); this deletant is functional in vivo and less prone to degradation in solution (Hornung et al, 2011). Confirming our hypothesis, the Ndc8025V159D complex failed to form a 1:1 interaction with the Mtw1Dsn1DN complex when mixed in equimolar concentrations (Figure 4B). The same result was observed for the Ndc8024L160D complex (Supplementary Figure S4), cnn1-spc24-12 5 12 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified range binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P43618:p.Ser74Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S D Wed May 02 16:43:23 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser74asp' Tue Jun 30 16:35:14 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser74Asp' 14 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified 9 weight by comassie molecular weight estimation by coomasie staining weight by comassie weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role neutral component neutral component purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f6g nuf2-cnn1 3 8 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P43618:p.Ser74Asp mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain S D Wed May 02 16:28:41 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'ser74asp' Tue Jun 30 16:07:29 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Ser74Asp' physical association physical association f6h nuf2-cnn1-1 3 8 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 12 anti tag western anti tag western blot anti tag western anti tag western anti tag western blot anti tag western unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell P43618:p.Val16Ala mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain V A Wed May 02 19:08:07 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'val16ala' Tue Jun 30 16:53:37 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Val16Ala' tag flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association f7b