IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ UCP4 is a target effector of the NF-κB c-Rel prosurvival pathway against oxidative stress. UCP4 is a target effector of the NF-κB c-Rel prosurvival pathway against oxidative stress. Free Radic. Biol. Med. (0891-5849) 2012 imex curation Ho J.W., Ho P.W., Liu H.F., So D.H., Chan K.H., Tse Z.H., Kung M.H., Ramsden D.B., Ho S.L. IBD - Inflammatory bowel disease slho@hku.hk 05-Jan-2015: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro emsa supershift electrophoretic mobility supershift assay emsa supershift tag perox activity tag visualisation by peroxidase activity tag perox activity Ho J.W., Ho P.W., Liu H.F., So D.H., Chan K.H., Tse Z.H., Kung M.H., Ramsden D.B., Ho S.L. IBD - Inflammatory bowel disease slho@hku.hk Accepted 2014-DEC-11 by MGT Free Radic. Biol. Med. (0891-5849) 2012 Only protein-protein interactions imex curation rel_human Proto-oncogene c-Rel REL protein protein human Homo sapiens Human MASGAYNPYIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGKVRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAIITRIKAGINPFNVPEKQLNDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRAPNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQVAIVFKTPPYCKAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLFQKLCQDHVETGFRHVDQDGLELLTSGDPPTLASQSAGITVNFPERPRPGLLGSIGEGRYFKKEPNLFSHDAVVREMPTGVSSQAESYYPSPGPISSGLSHHASMAPLPSSSWSSVAHPTPRSGNTNPLSSFSTRTLPSNSQGIPPFLRIPVGNDLNASNACIYNNADDIVGMEASSMPSADLYGISDPNMLSNCSVNMMTTSSDSMGETDNPRLLSMNLENPSCNSVLDPRDLRQLHQMSSSSMSAGANSNTTVFVSQSDAFEGSDFSCADNSMINESGPSNSTNPNSHGFVQDSQYSGIGSMQNEQLSDSFPYEFFQV 03E1033BDF7B1B30 ucp4_human_nfkb-site_dna-probe Human UCP4 gene promoter NF-kappaB sequence DNA probe dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human AATTCTAGAGGGGCTTTCCCAAACTCAA p19838-pro_0000030311 Nuclear factor NF-kappa-B p50 subunit NFKB1 DNA-binding factor KBF1 EBP-1 Nuclear factor of kappa light polypeptide gene enhancer in B-cells 1 protein protein human Homo sapiens Human MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQAEGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDFSPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFHPGTTKSNAGMKHG 1 433 5D027BB8EBCAA33A ucp4-nfkb1-1 1 3 unspecified role unspecified role bait bait 5' biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 4 unspecified role unspecified role prey prey human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells physical association physical association Fig. 3b Increased binding of p50 to UCP4 probe was observed when the probe was incubated with nuclear extracts from SH-SY5Y cells overexpressing human c-Rel. Increased binding of NF-kappaB proteins to UCP4 probe was observed when SH-SY5Y cells were treated with hydrogen peroxide (H2O2) (CHEBI:16240). Binding was decreased when unlabeled UCP4 probe was added as a competitor. ucp4-rel-1 1 3 unspecified role unspecified role bait bait 1' biotin tag biotin tag certain certain sequence position certain certain certain sequence position certain chemical synthesis Chemical synthesis (Chemical synthesis) 2 unspecified role unspecified role prey prey over-expressed over expressed level over-expressed human-sh_sy5y Homo sapiens SH-SY5Y cell line sh_sy5y Human neuroblastoma cells physical association physical association Fig. 3b Binding of c-Rel to UCP4 probe was only observed when the probe was incubated with nuclear extracts from SH-SY5Y cells overexpressing human c-Rel. Increased binding of NF-kappaB proteins to UCP4 probe was observed when SH-SY5Y cells were treated with hydrogen peroxide (H2O2) (CHEBI:16240). Binding was decreased when unlabeled UCP4 probe was added as a competitor. Q04864 increases expression at RNA level of ENSG00000153291 Q04864 increases expression at protein level of ENSG00000153291