IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Mutant PrP suppresses glutamatergic neurotransmission in cerebellar granule neurons by impairing membrane delivery of VGCC α(2)δ-1 Subunit. Mutant PrP suppresses glutamatergic neurotransmission in cerebellar granule neurons by impairing membrane delivery of VGCC α(2)δ-1 Subunit. Neuron (0896-6273) 2012 imex curation Senatore A., Colleoni S., Verderio C., Restelli E., Morini R., Condliffe S.B., Bertani I., Mantovani S., Canovi M., Micotti E., Forloni G., Dolphin A.C., Matteoli M., Gobbi M., Chiesa R. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. roberto.chiesa@marionegri.it Only protein-protein interactions mouse-brain-cerebellum Mus musculus brain cerebellum brain_cerebellum [Cerebellar] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Senatore A., Colleoni S., Verderio C., Restelli E., Morini R., Condliffe S.B., Bertani I., Mantovani S., Canovi M., Micotti E., Forloni G., Dolphin A.C., Matteoli M., Gobbi M., Chiesa R. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. roberto.chiesa@marionegri.it Accepted 2015-MAR-24 by PPORRAS Neuron (0896-6273) 2012 imex curation Mutant PrP suppresses glutamatergic neurotransmission in cerebellar granule neurons by impairing membrane delivery of VGCC α(2)δ-1 Subunit. Mutant PrP suppresses glutamatergic neurotransmission in cerebellar granule neurons by impairing membrane delivery of VGCC α(2)δ-1 Subunit. Neuron (0896-6273) 2012 imex curation Senatore A., Colleoni S., Verderio C., Restelli E., Morini R., Condliffe S.B., Bertani I., Mantovani S., Canovi M., Micotti E., Forloni G., Dolphin A.C., Matteoli M., Gobbi M., Chiesa R. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. roberto.chiesa@marionegri.it Only protein-protein interactions mouse-neuron Mus musculus neuronal cell neuron Neuron [Neuronal cell; Neural cell anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Senatore A., Colleoni S., Verderio C., Restelli E., Morini R., Condliffe S.B., Bertani I., Mantovani S., Canovi M., Micotti E., Forloni G., Dolphin A.C., Matteoli M., Gobbi M., Chiesa R. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. I have not added "granule cell " as a Tissue (it DOES have a BTO term) as these neurons are found in various brain locations, not just cerebellum. Cerebellar granule neurons from C57BL/6 mice. roberto.chiesa@marionegri.it Accepted 2015-MAR-24 by PPORRAS Neuron (0896-6273) 2012 imex curation Mutant PrP suppresses glutamatergic neurotransmission in cerebellar granule neurons by impairing membrane delivery of VGCC α(2)δ-1 Subunit. Mutant PrP suppresses glutamatergic neurotransmission in cerebellar granule neurons by impairing membrane delivery of VGCC α(2)δ-1 Subunit. Neuron (0896-6273) 2012 imex curation Senatore A., Colleoni S., Verderio C., Restelli E., Morini R., Condliffe S.B., Bertani I., Mantovani S., Canovi M., Micotti E., Forloni G., Dolphin A.C., Matteoli M., Gobbi M., Chiesa R. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. roberto.chiesa@marionegri.it Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Senatore A., Colleoni S., Verderio C., Restelli E., Morini R., Condliffe S.B., Bertani I., Mantovani S., Canovi M., Micotti E., Forloni G., Dolphin A.C., Matteoli M., Gobbi M., Chiesa R. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. Location of Insertion mutation in figure 6 taken from PMID:7592679. roberto.chiesa@marionegri.it Accepted 2015-MAR-24 by PPORRAS Neuron (0896-6273) 2012 Only protein-protein interactions imex curation Mutant PrP suppresses glutamatergic neurotransmission in cerebellar granule neurons by impairing membrane delivery of VGCC α(2)δ-1 Subunit. Mutant PrP suppresses glutamatergic neurotransmission in cerebellar granule neurons by impairing membrane delivery of VGCC α(2)δ-1 Subunit. Neuron (0896-6273) 2012 imex curation Senatore A., Colleoni S., Verderio C., Restelli E., Morini R., Condliffe S.B., Bertani I., Mantovani S., Canovi M., Micotti E., Forloni G., Dolphin A.C., Matteoli M., Gobbi M., Chiesa R. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. roberto.chiesa@marionegri.it Only protein-protein interactions human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Senatore A., Colleoni S., Verderio C., Restelli E., Morini R., Condliffe S.B., Bertani I., Mantovani S., Canovi M., Micotti E., Forloni G., Dolphin A.C., Matteoli M., Gobbi M., Chiesa R. Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. roberto.chiesa@marionegri.it Accepted 2015-MAR-24 by PPORRAS Neuron (0896-6273) 2012 imex curation prio_mouse Major prion protein PrP27-30 PrP33-35C Prnp Prn-p Prp protein protein mouse Mus musculus Mouse MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG DIP protein P04925 original sequence version: 157 DIP protein P04925 original sequence version: 140 DIP protein P04925 original sequence version: 122 DIP protein P04925 original sequence version: 117 DIP protein P04925 original sequence version: 132 DIP protein P04925 original sequence version: 128 D5331E6321826CC0 ca2d1_rat Voltage-dependent calcium channel subunit alpha-2/delta-1 Cacna2d1 Cacnl2a Cchl2a Voltage-gated calcium channel subunit alpha-2/delta-1 protein protein rat Rattus norvegicus (Rat) Rat MAAGCLLALTLTLFQSWLIGPSSEEPFPSPVTIKSWVDKMQEDLVTLAKTASGVTQLADIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLAMEAEKVQAAHQWREDFASNEVVYYNAKDDLDPERNESESGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFAADRLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQDVSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFTFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNVTGQSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKNPKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYRYLALVLPTYSFYYIKAKIEETITQARSKKGKMKDSETLKPDNFEESGYTFIAPREYCNDLKPSDNNTEFLLNFNEFIDRKTPNNPSCNTDLINRILLDAGFTNELVQNYWSKQKNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAPYFNKSGPGAYESGIMVSKAVELYIQGKLLKPAVVGIKIDVNSWIENFTKTSIRDPCAGPVCDCKRNSDVMDCVILDDGGFLLMANHDDYTNQIGRFFGEIDPRMMRHLVNISLYAFNKSYDYQSVCDPGAAPKQGAGHRSAYVPSITDILQIGWWATAAAWSILQQLLLSLTFPRLLEAVEMEEDDFTASLSKQSCITEQTQYFFKNDTKSFSGLLDCGNCSRIFHVEKLMNTNLVFIMVESKGTCPCDTRLLMQAEQTSDGPDPCDMVKQPRYRKGPDVCFDNNVLEDYTDCGGVSGLNPSLWSIFGLQFILLWLVSGSRHYLW 7054907D9D343B34 ca2d1_mouse Voltage-dependent calcium channel subunit alpha-2/delta-1 Voltage-gated calcium channel subunit alpha-2/delta-1 Cacna2d1 Cacna2 protein protein mouse Mus musculus Mouse MAAGCLLALTLTLFQSGLIGPSSEEPFPSPVTIKSWVDKMQEDLVTLAKTASGVTQLADIYEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLAMEAEKVQAAHQWREDFASNEVVYYNAKDDLDPERNESEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVLNELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRRRPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQDVSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIMLFTDGGEERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIRINTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNVTGQSENKTNLKNQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKPIGVGIPTINLRKRRPNVQNPKSQEPVTLDFLDAELENEIKVEIRNKMIDGESGEKTFRTLVKSQDERYIDKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTFIAPREYCNDLKPSDNNTEFLLNFNEFIDRKTPNNPSCNTDLINRILLDAGFTNELVQNYWSKQKNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAPYFNKSGPGAYESGIMVSKAVELYIQGKLLKPAVVGIKIDVNSWIENFTKTSIRDPCAGPVCDCKRNSDVMDCVILDDGGFLLMANHDDYTNQIGRFFGEIDPSMMRHLVNISLYAFNKSYDYQSVCDPGAAPKQGAGHRSAYVPSIADILQIGWWATAAAWSILQQLLLSLTFPRLLEAVEMEEDDFTASLSKQSCITEQTQYFFKNDTKSFSGLLDCGNCSRIFHVEKLMNTNLVFIMVESKGTCPCDTRLLMQAEQTSDGPDPCDMVKQPRYRKGPDVCFDNNVLEDYTDCGGVSGLNPSLWSIFGLQFILLWLVSGSRHYLL 103773B4735120D4 prnp-cacna2d1-3 1 7 unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:14:36 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was '3f4_epitope_tag_leu108met,val111met' physical association physical association 5A, Supp 5A An interaction was detected using Tg(WT) and Tg(PG14)- mice with a 72aa/octapeptide repeat insertion. After deglycosylation with PNGaseF, the observed band shifted to an apparent molecular weight of 107 kDa. cacna2d1-prnp-1 1 7 unspecified role unspecified role bait bait 5 unspecified role unspecified role prey prey undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:14:32 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was '3f4_epitope_tag_leu108met,val111met' physical association physical association 5Ai An interaction was detected using Tg(WT) and Tg(PG14)- mice with a 72aa/octapeptide repeat insertion. cacna2d1-prnp-2 3 5 unspecified role unspecified role neutral component neutral component undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:14:37 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was '3f4_epitope_tag_leu108met,val111met' codon_34 gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag certain certain sequence position certain certain certain sequence position certain 6 immunocytochemistry immunocytochemistry tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component colocalization colocalization 6C Blocking PrP in the ER or Golgi by artificial retention signals resulted in intracellular retention of a2d-1, as with the PG14 mutation. cacna2d1-prnp-3 3 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component codon_34 gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag certain certain sequence position certain certain certain sequence position certain undefined mutation mutation mutation insertion analysis insertion analysis range range range range Wed Jul 06 16:14:21 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was 'n_terminal_72_aminoacid/octapeptide_repeat' undefined mutation mutation mutation certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain Wed Jul 06 16:14:47 BST 2016 Sequence change details about this feature cannot be ascertained or do not fit with the current version of the referenced protein, so they have been deleted as a result of our quality control procedures. The original label was '3f4_epitope_tag_leu108met,val111met' colocalization colocalization 6F/I In cells expressing PG14/Delta-HC PrP, (with a deletion of PrP hydrophobic Core aas 114-121), a2d-1 was more efficiently delivered to the cell surface. Transgenic mice that express a mouse PrP mutation D177N/V128 also show altered colocalisation, -as for PG14 cells, with less colocalisation visible at the cell surface. In cells co-expressing the Hydrophobic core deletion (aas 114-121) (with D177N/V128) this effect is not seen. prnp-cacna2d1-1 2 5 unspecified role unspecified role bait bait 7 unspecified role unspecified role prey prey physical association physical association Supp 5A prnp-cacna2d1-2 4 6 immunocytochemistry immunocytochemistry western blot western blot Immuno blot Immuno blot unspecified role unspecified role prey prey 5 unspecified role unspecified role bait bait colocalization colocalization Supp 5C