UniProt UniProt http://www.uniprot.org New modularity of DAP-kinases: alternative splicing of the DRP-1 gene produces a ZIPk-like isoform. New modularity of DAP-kinases: alternative splicing of the DRP-1 gene produces a ZIPk-like isoform. PLoS ONE 2011 imex curation Shoval Y., Berissi H., Kimchi A., Pietrokovski S. Sequence coordinates for DRP-1/DAPK2 isoforms differ between publication (fig 1 and m+m section) and UniProt. In vitro kinase assay (fig 4D) not included as the substrate ('human MLC') cannot be mapped to UniProt. Shmuel.Pietrokovski@weizmann.ac.il 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Shoval Y., Berissi H., Kimchi A., Pietrokovski S. Sequence coordinates for DRP-1/DAPK2 isoforms differ between publication (fig 1 and m+m section) and UniProt. In vitro kinase assay (fig 4D) not included as the substrate ('human MLC') cannot be mapped to UniProt. Shmuel.Pietrokovski@weizmann.ac.il Accepted 2014-SEP-01 by ORCHARD PLoS ONE 2011 imex curation New modularity of DAP-kinases: alternative splicing of the DRP-1 gene produces a ZIPk-like isoform. New modularity of DAP-kinases: alternative splicing of the DRP-1 gene produces a ZIPk-like isoform. PLoS ONE 2011 imex curation Shoval Y., Berissi H., Kimchi A., Pietrokovski S. Sequence coordinates for DRP-1/DAPK2 isoforms differ between publication (fig 1 and m+m section) and UniProt. In vitro kinase assay (fig 4D) not included as the substrate ('human MLC') cannot be mapped to UniProt. Shmuel.Pietrokovski@weizmann.ac.il 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Shoval Y., Berissi H., Kimchi A., Pietrokovski S. Sequence coordinates for DRP-1/DAPK2 isoforms differ between publication (fig 1 and m+m section) and UniProt. In vitro kinase assay (fig 4D) not included as the substrate ('human MLC') cannot be mapped to UniProt. Shmuel.Pietrokovski@weizmann.ac.il Accepted 2014-SEP-01 by ORCHARD PLoS ONE 2011 imex curation q9uik4-2 Death-associated protein kinase 2 Beta DAPK2 DAP-kinase-related protein 1 protein protein human Homo sapiens Human MFQASMRSPNMEPFKQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSRASRRGVSREEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIKQILDGVNYLHTKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANITAVSYDFDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITSKGEGRAPEQRKTEPTQLKTKHLREYTLKCHSSMPPNNSYVNFERFACVVEDVARVDLGCRALVEAHDTIQDDVEALVSIFNEKEAWYREENESARHDLSQLRYEFRKVESLKKLLREDIQATGCSLGSMARKLDHLQAQFEILRQELSADLQWIQELVGSFQLESGSSEGLGSTFYQDTSESLSELLSRSCTEEFLAGWKL Contains a leucine zipper at positions 434-451. 34F716A709C569B8 atf4_human Cyclic AMP-dependent transcription factor ATF-4 Activating transcription factor 4 CREB2 ATF4 TXREB Cyclic AMP-responsive element-binding protein 2 Tax-responsive enhancer element-binding protein 67 protein protein human Homo sapiens Human MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP 3BBB7379DC3B0D07 DIP protein P18848 original sequence version: 181 DIP protein P18848 original sequence version: 117 No Uniprot Update and Caution removed " The protein could not be merged with EBI-12907955 because of some conflicts with the protein sequence (features which cannot be shifted)." -EBI-12907955 no longer exists. 3BBB7379DC3B0D07 dapk3_human Death-associated protein kinase 3 DAPK3 ZIPK DAP-like kinase Zipper-interacting protein kinase MYPT1 kinase protein protein human Homo sapiens Human MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCHEDVEALAAIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRYEALAKQVASEMRFVQDLVRALEQEKLQGVECGLR 56773008A6A61CF0 dapk3-atf4-3 1 4 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 5 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6 dapk2-atf4 2 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined Q9UIK4-2:p.[Leu434Ala;Ile441Ala;Phe448Ala] mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain L A certain certain sequence position certain certain certain sequence position certain I A certain certain sequence position certain certain certain sequence position certain F A Wed May 02 15:46:26 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'leu434ala,ile441ala,phe448ala' Tue Jun 30 16:27:55 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Leu434Ala;Ile441Ala;Phe448Ala]' 4 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association S4 dapk2-atf4-1 1 3 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6