IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ Structures of mouse SOD1 and human/mouse SOD1 chimeras. Structures of mouse SOD1 and human/mouse SOD1 chimeras. Arch. Biochem. Biophys. (0003-9861) 2010 imex curation Seetharaman S.V., Taylor A.B., Holloway S., Hart P.J. pjhart@biochem.uthscsa.edu 10-Mar-2014: Contacted by IntAct-Help. Only protein-protein interactions in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Seetharaman S.V., Taylor A.B., Holloway S., Hart P.J. pjhart@biochem.uthscsa.edu Accepted 2014-FEB-19 by PPORRAS Arch. Biochem. Biophys. (0003-9861) 2010 Only protein-protein interactions imex curation zinc(2+) zinc(2+) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) sodc_mouse Superoxide dismutase [Cu-Zn] Sod1 protein protein mouse Mus musculus Mouse MAMKAVCVLKGDGPVQGTIHFEQKASGEPVVLSGQITGLTEGQHGFHVHQYGDNTQGCTSAGPHFNPHSKKHGGPADEERHVGDLGNVTAGKDGVANVSIEDRVISLSGEHSIIGRTMVVHEKQDDLGKGGNEESTKTGNAGSRLACGVIGIAQ DIP protein P08228 original sequence version: 124 CAE548C66043BAC4 sod1-zinc_2__-1 1 2 unspecified role unspecified role unspecified role unspecified role 3 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) direct interaction direct interaction Table 1 Rworking = 0.16 Rfree = 0.2 2.4A