UniProt UniProt http://www.uniprot.org RTM3, which controls long-distance movement of potyviruses, is a member of a new plant gene family encoding a meprin and TRAF homology domain-containing protein. RTM3, which controls long-distance movement of potyviruses, is a member of a new plant gene family encoding a meprin and TRAF homology domain-containing protein. Plant Physiol. (0032-0889) 2010 imex curation Cosson P., Sofer L., Le Q.H., Léger V., Schurdi-Levraud V., Whitham S.A., Yamamoto M.L., Gopalan S., Le Gall O., Candresse T., Carrington J.C., Revers F. revers@bordeaux.inra.fr 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions allium_epidermis Allium cepa (onion) epidermis A thin surface layer of tissue in higher plants formed by growth of a primary meristem. bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Cosson P., Sofer L., Le Q.H., Léger V., Schurdi-Levraud V., Whitham S.A., Yamamoto M.L., Gopalan S., Le Gall O., Candresse T., Carrington J.C., Revers F. revers@bordeaux.inra.fr Accepted 2014-JUN-06 by ORCHARD Plant Physiol. (0032-0889) 2010 imex curation RTM3, which controls long-distance movement of potyviruses, is a member of a new plant gene family encoding a meprin and TRAF homology domain-containing protein. RTM3, which controls long-distance movement of potyviruses, is a member of a new plant gene family encoding a meprin and TRAF homology domain-containing protein. Plant Physiol. (0032-0889) 2010 imex curation Cosson P., Sofer L., Le Q.H., Léger V., Schurdi-Levraud V., Whitham S.A., Yamamoto M.L., Gopalan S., Le Gall O., Candresse T., Carrington J.C., Revers F. revers@bordeaux.inra.fr 21-Jul-2014: Contacted by IntAct-Help. Only protein-protein interactions yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cosson P., Sofer L., Le Q.H., Léger V., Schurdi-Levraud V., Whitham S.A., Yamamoto M.L., Gopalan S., Le Gall O., Candresse T., Carrington J.C., Revers F. revers@bordeaux.inra.fr Accepted 2014-JUN-06 by ORCHARD Plant Physiol. (0032-0889) 2010 imex curation rtm3_arath Protein RESTRICTED TEV MOVEMENT 3 MATH domain and coiled-coil domain-containing protein RTM3 Restricted tobacco etch virus movement protein 3 F9D24.260 At3g58350 RTM3 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MGKQFDKKITWTIKNFASLLSDLIYSDHFVVGGCKWHLRAYPKGYNNANSLSLFLGVAVPTSLPSGWRRHTKFRLTLVNQLSDKLSQSKLNELEQWFDEKTTNWGLSSMCPLNEIHAKDSGFLLNGELKIVVEIKVLETIGKLDVTEETSTITETVDVNGFQLLPSQAKSVSRMFAKHPELASDLRPKNPNLRTGYMSLLLSLIETLSQLPQQMSKDDLLDAYDALGSMRDAGFKLDWLEKKLYEVSEKKENEEASETGLQEMEEELKDMKQKCLEMEALVEKEKAKVSTAKAPISFDDIV 1CFC7A9E14EBD321 jal1_arath Protein RESTRICTED TEV MOVEMENT 1 RTM1 JAL1 Jacalin-related lectin 1 Restricted tobacco etch virus movement protein 1 T20M3.2 At1g05760 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKIGPVGKHDARSTTIVNWDEGSHDGFISQIFLSHGVAGIMSIQFQFVMDGKLVLSDRHGPFSGNMFDVIELNYPHEYITGISGEYYKYEANNPHMRSLKFNTNTSEYGPFGTSGSSNDKFAFKLGKSPQFGGFHGTYDASGLQYIGVYLRPKTVLPKIDTGNAEETESKIVLG F38A420E5EDF0224 rtm3-rtm3 2 3 unspecified role unspecified role bait bait 3 unspecified role unspecified role prey prey physical association physical association Fig. 5A, Fig. 5C rtm3-rtm1-1 2 3 unspecified role unspecified role bait bait D5K228:p.Glu284Lys mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain E K Wed May 02 20:11:33 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu284lys' Tue Jun 30 15:52:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu284Lys' 4 unspecified role unspecified role prey prey physical association physical association Fig. 5C rtm1-rtm3 1 3 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6 rtm1-rtm1 1 4 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6 rtm3-rtm3-1 1 3 unspecified role unspecified role neutral component neutral component region cyfp cYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 3 unspecified role unspecified role neutral component neutral component region nyfp nYFP undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association Fig. 6