IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo. In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo. Mol. Cell Proteomics (1535-9476) 2010 imex curation Baan B., Pardali E., ten Dijke P., van Dam H. vdam@lumc.nl 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_436 Human mammary gland adenocarcinoma mda_mb_436 Human mammary gland adenocarcinoma ATCC catalog # HTB-130 ATCC catalog# HTB-130 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Baan B., Pardali E., ten Dijke P., van Dam H. In Fig 5 (5A/B/C) I am regarding all cell lines as negative apart from the obvious positive 3 strongly staining ones. (WB shows no protein present for some (as shown in Fig 5E) vdam@lumc.nl Accepted 2015-FEB-02 by PPORRAS Mol. Cell Proteomics (1535-9476) 2010 Only protein-protein interactions imex curation In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo. In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo. Mol. Cell Proteomics (1535-9476) 2010 imex curation Baan B., Pardali E., ten Dijke P., van Dam H. vdam@lumc.nl 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_231 Homo sapiens Caucasian breast adenocarcinoma mda_mb_231 Human Caucasian breast adenocarcinoma pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Baan B., Pardali E., ten Dijke P., van Dam H. In Fig 5 (5A/B/C) I am regarding all cell lines as negative apart from the obvious positive 3 strongly staining ones. (WB shows no protein present for some (as shown in Fig 5E) vdam@lumc.nl Accepted 2015-FEB-02 by PPORRAS Mol. Cell Proteomics (1535-9476) 2010 Only protein-protein interactions imex curation In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo. In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo. Mol. Cell Proteomics (1535-9476) 2010 imex curation Baan B., Pardali E., ten Dijke P., van Dam H. vdam@lumc.nl 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-retina Human retina cells retina retinal tissue pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Baan B., Pardali E., ten Dijke P., van Dam H. "Retinoblasts" are presumably a mixture of immature cell types (no such term exists in Brenda) - references (no 31 and 4 more from there) give no further info. EBI-9302839:- Figure 3B- I cannot see Reference 32- but I am assuming the competing version of c-Jun must be human??? Adenovirus-transformed human embryonic retinoblasts (Ad-HERs). vdam@lumc.nl Accepted 2015-FEB-02 by PPORRAS Mol. Cell Proteomics (1535-9476) 2010 Only protein-protein interactions imex curation In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo. In situ proximity ligation detection of c-Jun/AP-1 dimers reveals increased levels of c-Jun/Fra1 complexes in aggressive breast cancer cell lines in vitro and in vivo. Mol. Cell Proteomics (1535-9476) 2010 imex curation Baan B., Pardali E., ten Dijke P., van Dam H. vdam@lumc.nl 26-Feb-2015: Contacted by IntAct-Help. Only protein-protein interactions human-mda_mb_435 Human cell line derived from the M14 melanoma cell line mda_mb_435 Human cell line derived from the M14 melanoma cell line This cell line is now thought to be derived from the M14 melanoma cell line. This cell line was originally thought to be a Human epithelial breast cancer cell line. see pmid: 17004106 pla proximity ligation assay pELISA pELISA PLA antibody detection identification by antibody antibody detection Baan B., Pardali E., ten Dijke P., van Dam H. In Fig 5 (5A/B/C) I am regarding all cell lines as negative apart from the obvious positive 3 strongly staining ones. (WB shows no protein present for some (as shown in Fig 5E) vdam@lumc.nl Accepted 2015-FEB-02 by PPORRAS Mol. Cell Proteomics (1535-9476) 2010 Only protein-protein interactions imex curation fos_human Proto-oncogene c-Fos Cellular oncogene fos G0/G1 switch regulatory protein 7 FOS G0S7 protein protein human Homo sapiens Human MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL DIP protein P01100 original sequence version: 99 DIP protein P01100 original sequence version: 166 DIP protein P01100 original sequence version: 186 DIP protein P01100 original sequence version: 156 9E3B2969347C90C8 jun_human Transcription factor AP-1 JUN Activator protein 1 Proto-oncogene c-Jun V-jun avian sarcoma virus 17 oncogene homolog p39 protein protein human Homo sapiens Human MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF DIP protein P05412 original sequence version: 119 DIP protein P05412 original sequence version: 114 DIP protein P05412 original sequence version: 185 DIP protein P05412 original sequence version: 145 DIP protein P05412 original sequence version: 202 DIP protein P05412 original sequence version: 206 DIP protein P05412 original sequence version: 163 DIP protein P05412 original sequence version: 175 DIP protein P05412 original sequence version: 189 DIP protein P05412 original sequence version: 169 0695E23AC4D33561 fosl1_human Fos-related antigen 1 FOSL1 FRA1 protein protein human Homo sapiens Human MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLGPSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAAKCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKEGDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPSTPEPCASAHRKSSSSSGDPSSDPLGSPTLLAL DIP protein P15407 original sequence version: 146 1B6492D709E66570 atf2_human Cyclic AMP-dependent transcription factor ATF-2 ATF2 CREB2 CREBP1 Activating transcription factor 2 cAMP response element-binding protein CRE-BP1 HB16 Cyclic AMP-responsive element-binding protein 2 protein protein human Homo sapiens Human MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPSSQSQPSGS 0190EEFAEC8891A7 fos-jun-1 3 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1C, 3B/D TPA (PMA)-tetradecanoyl phorbol acetate, or phorbol 12-myristate 13-acetate. A mitogen, and used here to increase expression of c-Jun and c-Fos. fos-jun-1 3 8 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 1C, Supp 1C, 3C/E. The addition of TPA (PMA)-tetradecanoyl phorbol acetate, or phorbol 12-myristate 13-acetate, did not affect the interaction to a significant degree. Using tethered (linked) heterodimers of ATF2 and c-Jun also gave a positive PLA signal. fos-jun-1 3 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range P05412:p.[Lys283Glu;Lys288Glu;Arg302Glu;Gln304Glu] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain R E certain certain sequence position certain certain certain sequence position certain K E certain certain sequence position certain certain certain sequence position certain K E certain certain sequence position certain certain certain sequence position certain Q E Fri Jul 22 11:05:35 BST 2016 This feature has been corrected as a result of our quality control procedures. The original label was 'arg302glu,lys288glu,lys283glu,gln304glu' Wed May 02 15:34:01 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'lys283glu,lys288glu,arg302glu,gln304glu' Tue Jun 30 17:10:53 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.[Lys283Glu;Lys288Glu;Arg302Glu;Gln304Glu]' proximity proximity close-contact colocalization neighbourhood interaction 2A/C atf2-jun-1 3 6 unspecified role unspecified role neutral component neutral component c_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range 8 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 2B/D fos-jun-1 3 6 competitor competitor competitor neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain 6 unspecified role unspecified role neutral component neutral component 5 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3 B/D fos-jun-1 3 8 unspecified role unspecified role neutral component neutral component 6 competitor competitor competitor neutral component neutral component regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 3C/E atf2-fos-1 3 6 unspecified role unspecified role neutral component neutral component 6 competitor competitor competitor neutral component neutral component regions sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain certain certain sequence position certain region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 7 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 4 B/C TPA (PMA)-tetradecanoyl phorbol acetate, or phorbol 12-myristate 13-acetate. A mitogen, and used here to increase expression of c-Jun and Fra-1. fos-fosl1-1 4 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5A In all three more invasive and aggressive cancer cell lines, (MDA-MB231, MDA-MB436 and MDA-MB435) high numbers of c-Jun/Fra1 signals were detected by PLA, whereas much lower numbers of c-Jun/Fra1 RCPs were obtained in the less invasive luminal-like cells (MCF7, T47D, and ZR75). Levels of c-Jun/ATF2 and c-Jun/c-Fos signals were low in all cancer lines examined. fos-fosl1-2 1 6 unspecified role unspecified role neutral component neutral component 7 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5A In all three more invasive and aggressive cancer cell lines, (MDA-MB231, MDA-MB436 and MDA-MB435) high numbers of c-Jun/Fra1 signals were detected by PLA, whereas much lower numbers of c-Jun/Fra1 RCPs were obtained in the less invasive luminal-like cells (MCF7, T47D, and ZR75). Levels of c-Jun/ATF2 and c-Jun/c-Fos signals were low in all cancer lines examined. fos-fosl1-3 2 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 5A, 6B. In all three more invasive and aggressive cancer cell lines, (MDA-MB231, MDA-MB436 and MDA-MB435) high numbers of c-Jun/Fra1 signals were detected by PLA, whereas much lower numbers of c-Jun/Fra1 RCPs were obtained in the less invasive luminal-like cells (MCF7, T47D, and ZR75). Levels of c-Jun/ATF2 and c-Jun/c-Fos signals were low in all cancer lines examined. fosl1-jun-1 3 7 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction 4 B/C-2 TPA (PMA)-tetradecanoyl phorbol acetate, or phorbol 12-myristate 13-acetate. A mitogen, and used here to increase expression of c-Jun and Fra-1. fosl1-jun-1 2 5 unspecified role unspecified role neutral component neutral component 6 unspecified role unspecified role neutral component neutral component proximity proximity close-contact colocalization neighbourhood interaction Supp 2B MMS (methyl methane-sulfonate) -an alkylating agent and carcinogen Treatment of basal-like MDA-MB231 cells with methyl methanesulfonate strongly induced both c-Fos and c-Jun.