UniProt UniProt http://www.uniprot.org Overexpression of optineurin E50K disrupts Rab8 interaction and leads to a progressive retinal degeneration in mice. Overexpression of optineurin E50K disrupts Rab8 interaction and leads to a progressive retinal degeneration in mice. Hum. Mol. Genet. (0964-6906) 2010 imex curation Chi Z.L., Akahori M., Obazawa M., Minami M., Noda T., Nakaya N., Tomarev S., Kawase K., Yamamoto T., Noda S., Sasaoka M., Shimazaki A., Takada Y., Iwata T. Origin of transfected constructs has been communicated by the authors. iwatatakeshi@kankakuki.go.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions rat-rgc5 Rattus norvegicus rgc5 rgc5 bifc bimolecular fluorescence complementation bifc tag fluorescence tag visualisation by fluorescence tag fluorescence Chi Z.L., Akahori M., Obazawa M., Minami M., Noda T., Nakaya N., Tomarev S., Kawase K., Yamamoto T., Noda S., Sasaoka M., Shimazaki A., Takada Y., Iwata T. similar results have been obtained using transfected COS1 cells. KG inactive fragments, mKG_N and mKG_C, have been fused N- and C-terminally to cDNA constructs (fig 6A). However, representation of results in fig 6B did not allow the differentiation of exact experimantal set ups. Origin of transfected constructs has been communicated by the authors. iwatatakeshi@kankakuki.go.jp Accepted 2014-AUG-20 by MGT Hum. Mol. Genet. (0964-6906) 2010 imex curation Overexpression of optineurin E50K disrupts Rab8 interaction and leads to a progressive retinal degeneration in mice. Overexpression of optineurin E50K disrupts Rab8 interaction and leads to a progressive retinal degeneration in mice. Hum. Mol. Genet. (0964-6906) 2010 imex curation Chi Z.L., Akahori M., Obazawa M., Minami M., Noda T., Nakaya N., Tomarev S., Kawase K., Yamamoto T., Noda S., Sasaoka M., Shimazaki A., Takada Y., Iwata T. Origin of transfected constructs has been communicated by the authors. iwatatakeshi@kankakuki.go.jp 18-Sep-2014: Contacted by IntAct-Help. Only protein-protein interactions chlae-cos_1 Chlorocebus aethiops COS-1 cells Grivet cos_1 CV-1 Simian cells (cercopithecus aethiops) transformed by SV40 confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Chi Z.L., Akahori M., Obazawa M., Minami M., Noda T., Nakaya N., Tomarev S., Kawase K., Yamamoto T., Noda S., Sasaoka M., Shimazaki A., Takada Y., Iwata T. similar results have been obtained using transfected COS1 cells. KG inactive fragments, mKG_N and mKG_C, have been fused N- and C-terminally to cDNA constructs (fig 6A). However, representation of results in fig 6B did not allow the differentiation of exact experimantal set ups. Origin of transfected constructs has been communicated by the authors. iwatatakeshi@kankakuki.go.jp Accepted 2014-AUG-20 by MGT Hum. Mol. Genet. (0964-6906) 2010 imex curation optn_human Optineurin HYPL Optic neuropathy-inducing protein E3-14.7K-interacting protein FIP-2 Huntingtin-interacting protein L Huntingtin yeast partner L NEMO-related protein Transcription factor IIIA-interacting protein OPTN FIP2 GLC1E NRP HIP7 Huntingtin-interacting protein 7 protein protein human Homo sapiens Human MSHQPLSCLTEKEDSPSESTGNGPPHLAHPNLDTFTPEELLQQMKELLTENHQLKEAMKLNNQAMKGRFEELSAWTEKQKEERQFFEIQSKEAKERLMALSHENEKLKEELGKLKGKSERSSEDPTDDSRLPRAEAEQEKDQLRTQVVRLQAEKADLLGIVSELQLKLNSSGSSEDSFVEIRMAEGEAEGSVKEIKHSPGPTRTVSTGTALSKYRSRSADGAKNYFEHEELTVSQLLLCLREGNQKVERLEVALKEAKERVSDFEKKTSNRSEIETQTEGSTEKENDEEKGPETVGSEVEALNLQVTSLFKELQEAHTKLSEAELMKKRLQEKCQALERKNSAIPSELNEKQELVYTNKKLELQVESMLSEIKMEQAKTEDEKSKLTVLQMTHNKLLQEHNNALKTIEELTRKESEKVDRAVLKELSEKLELAEKALASKQLQMDEMKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDAFEDGGRQSLMEMQSRHGARTSDSDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII DIP protein Q96CV9 original sequence version: 65 2BAF841BA515AAE2 rab8a_human Ras-related protein Rab-8A Oncogene c-mel RAB8A MEL RAB8 protein protein human Homo sapiens Human MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITPDQQKRSSFFRCVLL DIP protein P61006 original sequence version: 82 DIP protein P61006 original sequence version: 100 DIP protein P61006 original sequence version: 128 DIP protein P61006 original sequence version: 132 AA52DBF54A2CD056 optn-rab8a-3 1 4 unspecified role unspecified role neutral component neutral component region kusabira-green kusabira-green protein tag kusabira-green undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined P61006:p.Gln67Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 14:30:19 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln67leu' Tue Jun 30 19:27:16 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' constitutively active mutant locked in the active GTP-bound form P61006:p.Thr22Asn mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain T N Wed May 02 16:28:54 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'thr22asn' Tue Jun 30 19:54:48 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Thr22Asn' GDP-bound form 3 unspecified role unspecified role neutral component neutral component Q96CV9:p.Glu50Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E K Wed May 02 14:48:52 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu50lys' Tue Jun 30 20:13:19 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu50Lys' UniProt FTId: VAR_021539; dbSNP:rs28939688; involved in GLC1E region kusabira-green kusabira-green protein tag kusabira-green undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6B optn-rab8a-4 2 3 unspecified role unspecified role neutral component neutral component Q96CV9:p.Glu50Lys mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain E K Wed May 02 18:42:12 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'glu50lys' Tue Jun 30 18:36:47 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Glu50Lys' UniProt FTId: VAR_021539; dbSNP:rs28939688; involved in GLC1E region kusabira-green kusabira-green protein tag kusabira-green undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined 4 unspecified role unspecified role neutral component neutral component P61006:p.Gln67Leu mutation mutation certain certain sequence position certain certain certain sequence position certain Q L Wed May 02 15:42:06 BST 2018 This feature has been corrected as a result of our quality control procedures. The original label was 'gln67leu' Tue Jun 30 16:44:25 BST 2020 This feature has been corrected as a result of our quality control procedures. The original label was 'p.Gln67Leu' constitutively active mutant locked in the active GTP-bound form region kusabira-green kusabira-green protein tag kusabira-green undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined physical association physical association 6C